KEGG   Gallus gallus (chicken): 395900
Entry
395900            CDS       T01006                                 

Gene name
HOXB1
Definition
(RefSeq) homeobox protein Hox-B1
  KO
K09301  homeobox protein HoxA/B/D1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395900 (HOXB1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    395900 (HOXB1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 395900
NCBI-ProteinID: NP_001074328
CGNC: 10116
Ensembl: ENSGALG00000013454
Position
27
AA seq 310 aa
MDNTRMNSFLEYAICNRGTGAYHHLEQSSPSFPSCSGSPSSDTFHGEGRYGAGGSAVAAA
HLPPQSPGFFPAASGRSVPFAAAAPSAGYPTQNCSPGYGHHQLYLGQQDADGVYFQAAGY
SSSTGPHLGSLAEGYCGAVGQYQQQQHLYGQEQPGYLPGVYGNLSPSLNEDKDPACPSEP
CPNASAARTFDWMKVKRNPPKTAKVSEYGLLGQPNTIRTNFTTKQLTELEKEFHFNKYLT
RARRVEIAATLELNETQVKIWFQNRRMKQKKREKEGLAPPAASRSAKEASEASDQSNCTS
PEASPSSVSS
NT seq 933 nt   +upstreamnt  +downstreamnt
atggacaatactaggatgaactccttcttagagtatgcaatttgtaaccgtgggacgggc
gcctaccaccatttagagcaaagctccccttccttcccctcttgctcaggtagcccctcc
agtgacacttttcatggagaagggcgctacggtgcggggggcagcgcggtcgcggccgcc
catctccccccgcagagccccggcttcttccccgccgcctccgggcgctccgtgcccttc
gcggccgctgccccgagcgccgggtacccaacccaaaattgcagccccggctacgggcac
caccagctctacctcggccagcaggacgcggacggcgtgtacttccaggcggccgggtac
tcctccagcaccggaccccacctcggctccctggcagagggctattgtggggccgtaggg
cagtaccagcagcagcagcacctttacgggcaggagcagcccggttacttgcccggggtt
tacggcaacctctcgccttccctaaatgaggacaaagaccccgcgtgcccctccgagccg
tgccccaatgccagcgcggcgcggaccttcgattggatgaaagtgaagaggaaccccccc
aagacagccaaagtgtcggaatacgggctgctgggacagcccaacaccattcgcaccaac
ttcaccaccaagcagctgacggagctggagaaggagtttcactttaacaagtacctcacc
cgggcccggagggtggagatcgccgctacactggagctcaacgaaacccaagtcaagatc
tggttccagaacaggcggatgaaacagaagaagagggaaaaggaaggtctcgcccctcct
gctgcctccaggtccgcgaaggaagcgagtgaagcctcggatcagtccaactgcacctca
cctgaggcctcccccagctccgtgtcctcctga

DBGET integrated database retrieval system