KEGG   Gallus gallus (chicken): 395904
Entry
395904            CDS       T01006                                 

Gene name
ZFHX4
Definition
(RefSeq) zinc finger homeobox protein 4 isoform X1
  KO
K09380  zinc finger homeobox protein 4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395904 (ZFHX4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain plus zinc finger motifs
    395904 (ZFHX4)
SSDB
Motif
Pfam: Homeodomain zf-C2H2 Homeobox_KN zf-C2H2_4 zf-H2C2_5 zf-met zf-Di19 zf-C2H2_6 MerR_1 zf-C2H2_jaz
Other DBs
NCBI-GeneID: 395904
NCBI-ProteinID: XP_004939974
CGNC: 11690
Ensembl: ENSGALG00000037164
Position
2
AA seq 3599 aa
METCDSPTISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLRTDERKSEI
LLGFSVENAAATQVTSAKEIPCNECATSFPSLQKYMEHHCPNARLPVLKDDNESEISELE
DSDVENLTGEIVYQPDGSAYIIEDSKESGQNAQTGANSKLFSTAMFLDSLTSAGEKNEQS
ASAPMSFYPQIINTFHIASSLGKPFTADQAFPNTSALAGVGPVLHSFRVYDLRHKRDKDY
LTSDGSAKNSCVSKDVPNNVDLSKFDGCVSDGKRKPVLMCFLCKLSFGYIRSFVTHAVHD
HRMTLNEEEQKLLSNKYVSAIIQGIGKDKEPLISFLEPKKSTSVYPHFSTTNLIGPDPTF
RGLWSAFHVENGDSLQAGFAFLKGSASTAGSAEQPVGITQMPKAEVNLGGLSSLVANAPI
TSVSLSHSSSESNKLSESKDQENNCERQKETNTLHPNGEFPIKSEPTEPVEEEDEDTYSN
ELDDDEVLGELADSIGSKDFPLLNQSISPLSSSVLKFIEKGTSSSSATVSDDTDKTKQTA
AHRHNSNVTSNYSISGKDFADASASKDSPTALHPNETARGDEDSSVTPHQHSFTPSTPSA
GDGSPGSGIECPKCDTVLGSSRSLGGHMTMMHSRNSCKTLKCPKCNWHYKYQQTLEAHMK
EKHPEPGGSCVYCKTGQPHPRLARGESYTCGYKPFRCEVCNYSTTTKGNLSIHMQSDKHL
NNVQNLQNGNGEQVYGHTAPPSNPALSGCGTPSPSKPKQKPTWRCEVCDYETNVARNLRI
HMTSEKHMHNMMLLQQNMKQIQHNLHLGLAPAEAELYQYYLAQNIGLTGMKLENPADPQM
MINPFQLDPATAAALAPGLVNNELPPEIRLASGQLMGDDLSLLTAGELSPYISDPALKLF
QCAVCNKFTSDSLEALSVHVSSERLLPEEEWRAVIGDIYQCKLCNYNTQLKANFQLHCKT
DKHMQKYQLVAHIKEGGKTNEWRLKCIAIGNPVHLKCNACDYYTNSVDKLRLHTTNHRHE
AALKLYKHLQKHESTVNPDSCYYYCALCDYSTKVKLNLVQHVRSVKHQQTEGLRKLQLHQ
QGLAPEEDNLSEIFFVKDCPPNELEEQGEDTEGSAKSTSVAIGDDKDSSERDNTEAKKSS
KDSGIVTPEKEPKVNTVVGAQQLLLAKEEDGAAKKSKPPEDNKFCHEQVKENFYQCPYCN
YNSRDPNRIQMHVLSQHSMQPVICCPLCQDVLSNKMHLQLHLTHLHSVSPDCVEKLLMTV
PVPDVMMPNSMLLPAAASEKSERDTPATITAEGSGKYSGESPVDEKSTPGTDESKPGMEI
KSEEQKPPKESAETPDWNKSGSKDIKTTDSMPDQLNEQQKKQQLSVSDRHVYKYRCNHCS
LAFKTMQKLQIHSQYHAIRAATMCSLCQRSFRTFQALKKHLEAGHPELNEAELQQLCASL
PVNGELWAEGESMGQDDHALEQEIERDYEMEQEGKASPVGSDSSSIPDDMGSEPKRTLPF
RKGPNFTMEKFLDPSRPYKCTVCKESFTQKNILLVHYNSVSHLHKLKKVLQEASSPVPQE
TNSNTDNKPYKCSICNVAYSQSSTLEIHMRSVLHQTKARAAKLEPSGNISSGNSVAGNVN
SPSQGILDSMSLPAVNSKEPHLDAKELNKKQASELISAQPTHHPPQSPAQLQMQLQHELQ
QQAAFFQPQFLNPAFLPHFPMTPEALLQFQQPQFLFPFYIPGTEFSLSPDLGLPGSATFG
MPGMAGMTGSLLEDLKQQIQTQHHVGQTQLQILQQQAQQYQSTQPQLQSQKQQQQSSKLM
KAEQTSLVSTDCQLIKDMPSYKESEEISEKQEKPKQEFTNESEGLKENKDMKKPKSSEPA
IPPPRIASGARGNAAKALLENFGFELVIQYNENRQKVQKKGKTGEGENTDKLECGTCSKL
FSNILILKSHQEHVHGQFFPYGALEKFARQYREAYDKLYPISPSSPETPPPPPPPPPPPP
PPPPPTPSQPSSAGAGKIQNTTPTPLQAPPPTPPPPPPPPPPPPPPPPPPSAPPQVQLPV
SLDLPLFPPIMMQPVQHPALPPQLALQLPPMDTLSADLTQLCQQQLGLDPNFLRHSQFKR
PRTRITDDQLKILRAYFDINNSPSEEQIQEMAEKSGLSQKVIKHWFRNTLFKERQRNKDS
PYNFSNPPITVLEDIRIDPQPSAVEPYKSDASFSKRSSRTRFTDYQLRVLQDFFDTNAYP
KDDEIEQLSTVLNLPTRVIVVWFQNARQKARKSYENQAETKDNEKRELTNERYIRTSNMQ
YQCKKCSVVFPRIFDLITHQKKQCYKDEDDDAQDESQTEDSMDASDQTVYKNCTVSGQND
ASKSLAVTAASSGSGSSTPLIPSPKPEPEKASPKSESTEKPKPNETISKQTDTTSQSSKP
VQSASVTPSDPQPSASQPQQQKQSQIIGRPPSTSQTTPVPSSPLPISMTPLQNSLPPQLL
QYQCDQCTVAFPTLELWQEHQHMHFLAAQNQFIHSQFLERPMDMPYMIFDPNNPLMTGQL
LNSSLAQMPPQTGSSHAAHPATVSGSMKRKLDDKEDNNCSEKEGGNSGEDQHRDKRLRTT
ITPEQLEILYEKYLLDSNPTRKMLDHIAREVGLKKRVVQVWFQNTRARERKGQFRAVGPA
QSHKRCPFCRALFKAKSALESHIRSRHWNEGKQAGYSLPPSPLISTEDGGDSPQKYIFFD
YPSLSLAKTELSSENELASTVSTPISKTAEMSPKNLLSPSSFKAESSEDIENLNAPPADS
AYDQNKTDFDETSSINTAISDATTGDEGNNEMESTTGSSGDAKPASPPKEPKPLVNDALT
KAATTPTNENTDDKFLFSLTSPSIHFSEKDGDHDQSYYITDDPDDNADRSETSSIADPSS
PNPFGASNPFKSKNSDRPGHKRFRTQMSNLQLKVLKACFSDYRTPTMQECEMLGNEIGLP
KRVVQVWFQNARAKEKKFKINIGKPFMINQTGPDGTKPECSLCGVKYSARLSIRDHIFSK
QHITKVRETVGSQLDREKDYLAPTTVRQLMAQQELDRIKKATDVLGLTVQQPGMMDSSSL
HGISLPAAYPGLPGLPPVLLPGMNGPSSLPGFPQSSNTLTSPGAGMLGFPTSATSSPALS
LSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPPSSSLSGQQTEQQSKESEKKNTINKPN
KVKKIKEEELEANKPEKHLKKEEKISSALSVLGKVVGEAHVDPTQLQALQNAIAGDPASF
IGGQFLPYFIPGFASYFTPQLPGTVQGGYLPPVCGMESLFPYGPAVPQTIAGLSPGALLQ
QYQQYQQNLQDSLQKQQKQQQEQQQKQVQAKSSKAENDQQQNSSDTSETKEDRSSATEST
KEEPQLDSKSADFSDTYIVPFVKYEFICRKCQMMFTDEDAAVNHQKSFCYFGQPLIDPQE
TVLRVPVSKYQCLACDVAISGNEALSQHLQSSLHKEKTIKQAMRNAKEHVRLLPHSVCSP
NPNTTSTSQSAASSNNTYPHLSCFSMKSWPNILFQASARKAASSPSSPPSLSLPSTVTSS
LCSTSGVQTSLPTESCSDESDSELSQKLEDLDNSLEVKAKPASGLDGNFNSIRMDMFSV
NT seq 10800 nt   +upstreamnt  +downstreamnt
atggaaacctgtgactcccctactatctcaaggcaggaaaatgggcagagcacatcaaag
ctatgtggaacaacacaacttgataatgaggtgccagagaaagttgcagggatggagcct
gacagggaaaacagctctacagatgacaacctgagaacggatgagcgcaaaagtgaaatc
ttgctgggtttcagtgtagagaatgcagctgccactcaggttacctcagcaaaggagata
ccctgcaacgaatgtgccacttcttttcccagtttacagaaatacatggaacaccactgt
cctaacgcccgccttcctgtcttgaaggatgacaatgagagtgaaataagtgagttagag
gacagtgatgtggagaatttaacaggggaaatagtttaccagcctgatgggtcagcatat
ataattgaggactccaaagaaagtgggcagaatgcacagactggagcaaatagtaaactc
ttttctacagcgatgtttctggactctctcacatcagctggagagaagaatgagcagtct
gcttctgcacctatgtcgttctacccacaaatcatcaacacttttcatatcgcttcatcc
ctcgggaaaccatttacagccgatcaggctttcccaaatacctcagcattagcaggagtt
ggtcctgtgttgcacagtttccgtgtctatgatctccgacacaagagagataaagactat
ctaaccagtgatggctcagccaaaaactcctgtgtgtccaaagatgttcctaacaatgtg
gacttgtctaaatttgatggttgtgttagtgatgggaaaaggaaacctgttttaatgtgt
ttcttgtgcaagttgtcttttggttatattaggtcatttgtaacccatgctgtgcatgat
catcggatgaccctcaatgaagaggagcaaaagcttctcagtaataaatatgtctccgcc
ataatacaggggattggcaaagacaaagaacctcttataagctttctggaaccaaaaaaa
tccacttctgtttatccccatttttctactacaaacctcataggccctgatccaaccttc
cgtggtttatggagtgcttttcatgttgaaaatggtgactctttgcaggctggctttgca
ttcttaaaaggaagtgcaagcactgctggttcagcagagcagccagtagggatcacccaa
atgccaaaggctgaagtgaacctggggggactgtctagtttagtagcgaacgccccgatt
acctctgtgtccctcagccactcatcatctgagtcaaacaagctgtcagagagcaaagac
caagagaacaactgtgaaaggcagaaagaaaccaacacgttacatcctaatggggagttc
cctatcaaaagtgaacccactgaaccagtagaagaagaagatgaagatacatattcaaat
gaacttgatgatgatgaggtattaggtgaactagcagatagtattggtagcaaagatttc
cctctcttaaaccaaagcatttctcctttatcatccagtgtgctaaaatttatagaaaag
ggtacctcttcctcctctgcgactgtttccgatgacacagataagacaaaacagactgct
gcacacagacataatagcaatgttactagtaactatagcattagtggcaaggactttgca
gatgcaagtgccagtaaagacagtcccacagctcttcatccaaatgaaacagcgagagga
gatgaagatagttctgttactcctcaccagcacagctttacacctagcacgcccagtgcg
ggtgacggctcaccaggaagtggcattgagtgtcccaaatgtgacacagttctggggtct
tcacgctccctaggtggccacatgaccatgatgcattctcggaattcatgcaaaactctc
aaatgtcccaaatgtaactggcactacaaatatcagcagaccctagaggcccatatgaag
gagaaacaccctgagcctgggggctcttgtgtttattgtaagactggacagcctcacccc
cggcttgccaggggtgaaagttacacttgtggctataaacccttccgctgcgaggtttgt
aactactctacaactaccaaaggcaacctcagtattcatatgcagtcagacaagcaccta
aacaatgttcaaaatcttcaaaatgggaatggtgaacaggtttacggtcacacagccccg
ccgtctaaccctgcccttagtggctgtgggacaccatctccatcaaaaccaaaacagaaa
cccacgtggcgctgtgaggtttgtgactatgaaactaacgtggcaaggaaccttcgcatt
cacatgaccagtgagaagcacatgcataacatgatgctcttgcagcagaacatgaaacag
atccagcacaacctgcacttaggccttgcgcccgcggaggcagagctctaccagtactac
ctagcccagaacatcggcctgactggaatgaaactggagaacccagcagacccgcagatg
atgatcaatccattccagcttgatccagcaactgctgcagctttggcgccaggacttgta
aataatgagctgccgcctgaaatccggcttgccagtggtcagctaatgggtgatgacctg
tccctccttactgcaggagagctgtcaccttatatcagtgacccagcgctgaagctattc
cagtgtgctgtttgcaacaaattcacctctgacagcctggaggccctaagtgtgcatgtg
agcagcgagcgcttgctccccgaagaggagtggagggctgtaattggagacatctaccag
tgcaagctctgtaactacaacactcagctcaaagcgaacttccagctccactgcaagact
gacaaacatatgcagaagtatcaactggtggctcacattaaagaagggggcaaaactaat
gagtggaggctgaagtgtattgccattggcaacccggttcacctaaaatgtaatgcctgt
gactactacaccaacagcgtggataaattgcgcttacatactaccaatcacaggcatgaa
gcagccctgaaactgtacaagcacttgcaaaagcacgagagcacagtaaatcccgactcc
tgctattactactgtgctctgtgtgattactccaccaaggtcaagttgaacctggtacag
catgtccgctcagtgaagcaccagcagacagagggcctacgcaagctccagctacaccag
caagggctggcaccagaggaggacaacctcagtgagatattttttgtcaaagactgccca
ccaaatgagctcgaagaacaaggtgaagatacagaagggtctgctaaaagtacgtcagtg
gctattggtgatgataaggactcaagtgagagagacaatactgaagctaaaaaatctagt
aaagactccggaatagtcacaccagagaaggaaccaaaagtgaacactgtggtaggggca
caacaacttcttctggcaaaagaagaggatggtgcagctaaaaaatcaaagcctccagag
gacaataaattttgtcatgagcaggtaaaggaaaatttttatcagtgtccttattgtaac
tacaatagtagggacccaaatcgtatccagatgcatgtcctgtcacagcattcaatgcaa
cctgttatctgctgccccctctgccaggatgtcctcagcaacaaaatgcatctccagctt
catttgacccatttgcacagtgtgtcacctgactgtgtggagaagctgctcatgactgtt
cctgtgccagatgtcatgatgcccaatagtatgctattgccagcagctgcttcagagaaa
tctgaacgtgacacacctgcaaccattacagctgagggatctgggaaatattcaggtgaa
agtcctgtggatgagaaaagtacaccggggactgatgaatcaaaacctggaatggaaatt
aagagtgaggaacagaagccacctaaagaatctgctgaaactccagattggaataagagt
ggcagtaaagatataaagaccacagattcaatgccagatcagctaaatgaacagcagaag
aagcaacagctctctgtttctgaccgccatgtctataagtatcgttgtaaccattgtagc
ttggcttttaagactatgcagaagcttcaaatacattcccagtatcatgctattcgggca
gctaccatgtgtagcctttgccaacgtagcttccgtacattccaggctttaaaaaaacac
ttggaagcaggccaccctgaactcaatgaagctgaacttcagcagctgtgtgcatcttta
cctgttaatggtgaactctgggcagaaggtgaaagtatgggacaagatgatcatgcacta
gagcaggaaatagaaagagattatgagatggagcaggaaggtaaagcaagtcctgtagga
agtgatagtagctctattccagatgatatgggctcagaaccaaagcgaaccttacctttt
agaaaagggccaaattttactatggaaaaatttctagatccgtctcgcccgtataagtgt
acagtatgtaaagagtcttttactcaaaagaacattctcctggtccactataactcagtc
tcccatctacataaactcaaaaaggttttgcaggaagcatcaagtcctgtccctcaagaa
accaacagcaacactgacaacaaaccctacaaatgcagcatttgtaatgttgcatatagc
caaagttctacattggaaatccacatgagatctgtgcttcatcagacaaaggcaagggct
gcaaaattagaaccaagtggtaatataagtagcggaaatagcgtagcagggaatgttaat
agccccagccaaggaatactagattctatgagtttaccagcagttaacagcaaagaacca
catttagatgccaaagaattaaataaaaaacaagcttctgaattaatttctgctcaacct
acacatcacccaccccagtcaccagcacaacttcaaatgcaactacagcatgaactgcaa
cagcaagctgcattctttcaaccccagtttctaaacccagcttttttgcctcactttcca
atgacaccagaagcactcctacagttccaacagcctcaattccttttcccattttatata
cctgggacagaatttagcttaagcccagacctgggtttgcctggttctgccacatttggt
atgcctggaatggctggtatgacaggatcattgctggaagatttgaagcagcagatacaa
actcagcaccatgttggtcaaacacagctacagatactgcagcaacaagcacaacaatat
caatccacccaaccccaacttcagtcccaaaaacagcagcagcaaagcagcaagctgatg
aaagcagagcaaactagcttagtaagcacagactgccagttgataaaggatatgccttca
tataaggagtcagaagagatttctgagaaacaagagaagccaaagcaagaatttactaac
gagagtgaaggattaaaagaaaacaaagatatgaagaaaccaaaatcctcagaaccagcc
atcccaccacccagaatagcttctggagcaagggggaatgcagccaaggctttattggag
aactttggttttgagttagttatccaatacaatgagaacagacaaaaagtgcagaaaaaa
ggcaagactggtgaaggtgaaaatacagacaaactagaatgtggaacctgcagtaagctc
ttttccaacattcttattctgaagagtcatcaagaacatgtgcatggacagttttttcca
tacggagcattagaaaagtttgctcgacagtacagggaggcatatgacaagctttatcca
atttctccatcttctccagaaacacctccaccgccaccaccacctccgccaccaccgcca
cctcctcctcctccaactccttctcagccttcttcagctggggctggaaaaattcaaaac
acaactcccactcctttgcaagctccaccacccacaccaccaccacctcctcctcctcca
ccaccacctcctccaccaccaccaccaccatctgccccacctcaagtccagcttcctgtt
tcacttgatctcccactcttccctccaattatgatgcagccagtgcagcatcctgcactg
cctcctcagcttgccctccagttgccaccaatggatactttgtctgcagatcttacccag
ctttgtcagcagcagctgggattagatcctaatttcctgcgccactctcagttcaagcgt
ccacgtacacgaatcacagatgatcagttaaaaatattgagggcttattttgatattaac
aattctccaagtgaggaacagatccaagaaatggctgagaagtctggtctttcacagaaa
gttatcaagcactggtttcgtaatacactgtttaaagaacgccagagaaataaagattct
ccgtataacttcagcaaccctcccataacagtgttggaagatatcagaatagatcctcag
ccttcagctgttgaaccttacaagtctgatgcatctttcagcaaaaggtcatctagaaca
cggtttactgattaccagcttcgtgtcctccaagacttctttgatacaaatgcttatcca
aaggatgatgaaattgaacagctttcaactgttcttaacctacctactcgagttattgtt
gtatggttccaaaatgcacgacagaaagctcgcaaaagttatgaaaatcaagctgaaact
aaggacaacgagaaaagggaattgacgaatgaacgctacatacgaactagtaacatgcag
tatcagtgcaaaaagtgcagtgtggtttttcccagaatctttgatttgattacacaccag
aaaaagcagtgttataaagatgaagatgatgatgctcaagatgaaagtcaaactgaagat
tccatggatgcctcagatcaaacagtatataagaactgcacagtttctggccaaaacgat
gcatcaaaaagcctggcagttacggcagcaagctctggctctggttctagtactcctttg
attccatcccccaaaccagagcctgagaaggcttctcctaaatcagagtcaactgaaaaa
ccaaaaccaaatgaaaccatctccaagcaaactgatacaacttcccaaagctccaaacca
gtacaatctgcttcagtaaccccttctgatcctcagccctctgcttcacaaccacaacaa
caaaaacaatcacaaataatagggagacctccttctacatcacagactacacctgttcct
tccagtcctttaccaatttcaatgactcctctacagaacagtctacctcctcagttatta
cagtaccaatgtgatcagtgtacagttgcctttccaactctagaactttggcaagagcac
cagcacatgcatttcctagcagcccaaaaccaatttattcactcacagtttctagagaga
ccaatggatatgccctatatgatatttgatcccaataatcctttgatgactggacagtta
cttaatagttcccttgctcagatgccaccacagactggctcatcacatgcagcacaccct
gccacagtttctggttccatgaaacgaaaactggatgataaagaagacaataactgtagc
gagaaagagggaggaaacagtggagaagatcaacatcgcgataagcgtttaagaactaca
attactccagagcagctggaaatactctatgaaaagtacctgctagattccaaccccacc
agaaagatgctagatcacattgcacgtgaagtgggacttaaaaagagagttgtacaagtc
tggtttcagaacacaagagccagagaaagaaaaggacagttccgtgctgttggtccagcc
cagtcccataaaaggtgtcctttttgtcgagctctgtttaaagcaaaatcagctttagaa
agtcacattcgctctcgacattggaatgaagggaaacaggcaggttatagtttgcctcca
agtcctttgatatcaactgaagatggaggagatagtccgcaaaaatacatattttttgat
tacccatcattgtcattagcaaaaactgaactatcaagtgaaaatgaactagcctccact
gtatcaacgcccattagcaaaactgcagaaatgtcaccaaaaaatctcttaagtccttct
tcttttaaagcagagtctagtgaggatatagaaaatttgaatgcccctcctgctgactct
gcgtatgatcaaaacaagactgactttgatgagacttcgtcaattaatacagcaattagt
gatgccacaacaggagatgaggggaacaatgaaatggagagcacaactggcagttcaggg
gatgcaaagcctgcatcacctcccaaagaaccaaaaccacttgtgaatgatgcgctaaca
aaagctgcaacaacacctacgaatgagaatactgatgataagtttctcttttcccttaca
agcccctcaatacatttcagtgaaaaagatggtgatcatgaccaaagttactacattact
gatgaccctgatgacaatgccgaccgcagtgaaacttcaagcatagctgatccaagttca
cctaacccctttggagctagcaatccctttaaatccaaaaacagtgatcggccaggccac
aaacgtttccgaacacaaatgagtaaccttcagcttaaagttctcaaagcttgctttagt
gactaccggactccaacaatgcaagaatgtgaaatgttagggaatgagattggtctgccc
aaacgtgtggtccaagtctggtttcagaatgcacgggcaaaagaaaagaaattcaaaatt
aacatagggaagccattcatgataaatcagactgggcctgatgggacaaagccagaatgc
tctctatgtggtgtaaaatattctgcacgtttgtccataagagatcatatcttttccaaa
caacatattacaaaagtgagagaaactgtgggaagtcagcttgatcgggagaaagattac
ttagctcctacaacagttagacagctgatggcgcagcaagaattggatcgaataaaaaag
gctactgatgtgctaggattaacagtacagcagccgggtatgatggacagcagttctctt
catggcatcagtttgccagcagcttatccaggactccctggccttcctcctgttcttcta
cctggaatgaatggtccatcctccttacctggatttccgcaaagttcaaacactttaaca
tctcctggtgcaggcatgcttgggtttcctacttcagctacttcgtctcctgccctgtct
ctcagcagtgccccctccaaacctttgctgcagactccaccaccaccacctccaccacca
ccaccacctccaccacctcctcctcctcctcctcctcctccctcctcctctttgtcagga
cagcagacagagcaacagagcaaagaatctgagaaaaaaaacactattaataagccaaac
aaggtcaaaaaaatcaaagaggaggaattagaggccaacaaacccgaaaaacacctgaaa
aaagaggaaaaaatctcatctgctctttcagtgttgggcaaagttgtaggggaagcgcac
gtggaccctactcagctgcaagcacttcaaaatgcaattgctggtgacccagcttcattt
ataggtgggcagttcttgccgtactttattcctgggtttgcttcgtattttacacctcag
cttcctggaacagtgcaaggagggtacctccccccagtctgtggtatggagagccttttt
ccctatgggccggcagtgcctcagacaattgctggcttgtcaccgggagcactgttgcag
cagtatcaacagtatcagcagaacctccaggattcattacaaaagcaacagaaacagcag
caagaacagcagcagaaacaagttcaagcaaagtcatctaaagcagagaatgaccaacag
caaaactccagcgacacttcggaaacaaaagaagacagaagttctgctacagaaagcaca
aaagaagaaccccagttagattcaaaaagtgcagacttttcagacacttacattgttcca
ttcgtcaagtatgagtttatatgcagaaagtgccagatgatgtttactgatgaagatgca
gcagtaaatcatcaaaagtccttctgttacttcggtcagcctttgattgacccacaagag
acagtgcttcgtgtcccagtcagcaaatatcagtgtcttgcctgtgatgtggctatcagt
ggaaatgaagcacttagccaacacctccagtcaagcttgcacaaagagaaaacaatcaaa
caagcaatgagaaatgccaaagagcatgttagattattacctcactcagtctgctcccct
aatcctaacaccacatctacctcgcagtctgcagcttcttctaataacacctatcctcat
ctttcttgcttctccatgaagtcctggcctaatattcttttccaagcgtctgccaggaaa
gctgcttcttccccttcttctcctccttccctttccttgccttcaacggttacctcaagt
ttgtgcagcacctcaggggttcaaacctcactacccacagaaagttgttcagatgagtct
gacagtgagttgagccagaagctggaagacttagataattctttggaagtgaaggctaag
cctgcttctggcctagatggtaatttcaatagcatcagaatggatatgttcagtgtgtag

DBGET integrated database retrieval system