KEGG   Gallus gallus (chicken): 395905
Entry
395905            CDS       T01006                                 

Gene name
EIF4G2
Definition
(RefSeq) eukaryotic translation initiation factor 4 gamma 2 isoform 2
  KO
K03260  translation initiation factor 4G
Organism
gga  Gallus gallus (chicken)
Pathway
gga03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    395905 (EIF4G2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    395905 (EIF4G2)
   03012 Translation factors [BR:gga03012]
    395905 (EIF4G2)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     395905 (EIF4G2)
   mRNA cycle factors
    Stress granule specific factors
     395905 (EIF4G2)
Translation factors [BR:gga03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    395905 (EIF4G2)
SSDB
Motif
Pfam: MIF4G W2 MA3
Other DBs
NCBI-GeneID: 395905
NCBI-ProteinID: NP_001036814
CGNC: 4160
Ensembl: ENSGALG00000005587
UniProt: Q5KTT9
Position
5
AA seq 864 aa
MESAIAEGGASRFSASSGGGGGRGAPQHYPKTASNSEFLGKTPGQNAQKWIPSRSTRRDD
DSANDKERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEE
PKYSSLYAQLCLRLAEDAPNFDGPSAESHPGQKQSTTFRRLLISKLQDEFENRTRNVDIY
DKHDGPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRVQLK
DMGEDLECLCQIMRTVGPRLDHAKAKSLMDQYFARMRSLMSSKELPARIRFLLQDTVELR
EHNWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMSQVMRSDFFLEGPFMPPRMKLDR
DPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHLMPSAQPQFGEL
GKSFLKNQISLRPAQAFLMNKNQVPKLQPQITMIPPSAQPPRTQTPPLGQPPQLGLKTNP
PLIQEKPAKTTKKPPPSKEELLKQTEAVVTEYLNNGNANDAVNAVREMRAPKHFIPEMLS
KVISQSLDRSDEDKEKASTLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYL
AQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQK
MLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKSDPSPQAIYKWIKDNISPKLH
VDKGFVNILMTSFLQYISSEVNPPSDESDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDH
VDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKA
LFQVNQWLTWLETAEEEESEEEAD
NT seq 2595 nt   +upstreamnt  +downstreamnt
gtggagagtgcgattgcagaagggggtgcttctcgtttcagtgcttcttcaggcggagga
ggtggtaggggtgcacctcagcactatcccaagactgccagcaacagcgagttcctgggg
aaaaccccagggcaaaacgctcagaaatggattccttcacgaagcactagacgagatgac
gactccgcaaacgacaaagaacgacatgatgcaatcttcaggaaagtaagaggcatacta
aataagcttactcctgaaaagtttgacaagctatgccttgagctcctcaatgtgggtgta
gagtctaagctcatccttaaaggggtcatactgctgatcgtagacaaagcccttgaagag
cccaagtatagctcactgtatgctcaactatgtctgcgactggcagaagatgcacccaac
tttgatggcccatctgcagagagtcatccaggacagaagcaaagcacaacattcagacgc
ctcctaatatctaaacttcaagatgaatttgaaaacagaaccagaaatgttgatatctat
gataagcatgatggtcccctcctccctgaggaggaggaacagagagccattgccaagatc
aagatgctggggaacatcaaattcattggagaacttggcaagcttgaccttattcatgaa
tctatccttcataagtgcatcaaaacacttttggaaaagaagaagagagtccaactcaaa
gatatgggggaggatttggagtgcctctgtcagataatgaggacagtgggacctagatta
gaccatgcaaaagccaagtccttaatggatcagtactttgcccgaatgcgctccttgatg
tcaagtaaggaattgccagcaaggattcgtttcctgctgcaggatactgtggagttgaga
gaacacaactgggttcctcgcaaagcttttcttgacaatggaccaaagactatcaatcaa
atccgtcaagatgcggtaaaagatctgggagtttttattcctgctcctatgtctcaagtg
atgagaagcgacttctttctggagggaccctttatgccacccaggatgaaacttgacagg
gacccactcggagggcttgctgatatgtttggacaaatgccaggtagtggaattggtact
ggtccaggagttattcaggatagattttcacccactatgggacgccatcgttcaaaccaa
cttttcaatggccatgggggtcacctcatgccttctgctcaaccccagtttggagaacta
ggcaaatcttttctgaaaaatcagataagcctgagacctgctcaggcttttctaatgaat
aaaaaccaagtgccaaagcttcagccccagataactatgattcctcccagtgctcaacca
ccacgcactcagacgccacctttgggacagcctcctcaacttggtcttaaaacaaatcca
ccacttatacaagaaaagcctgcaaagaccaccaagaagccacctccttctaaagaagag
ctacttaaacaaactgaagctgttgtgactgagtatctgaataatggcaatgctaatgat
gctgtcaacgctgtgagagaaatgagagctccaaaacacttcattcctgagatgttgagc
aaagtaatcagtcagtccctcgatcgatcagatgaagacaaagagaaagcaagtactttg
atcagcttactcaaacaggagggaatagccacaagtgacaacttcatgcaggcattcctg
aacgtattggaccagtgccccaaactggaggtggacatcccattggtgaaatcctactta
gcacagtttgcagcccgtgccattatttcagaactggtgagcatttccgaactggctcaa
ccactggaaagtggcactcatttccctctcttcctgctttgccttcagcagttagctaag
ttgcaagatcgtgaatggctaacagaattgttccaacaaagcaaagtgaacatgcagaaa
atgttaccagaaattgaccagaacaaggaccgcatgctggagatcttagaagggaaaggg
cttagcttcttattcccacttctgaaactggagaaggaactgctaaagcaaataaaatcg
gatccatccccacaagccatctataagtggattaaagataacatttcacccaagcttcat
gtagataaaggatttgtgaatatattgatgaccagtttcttgcagtatatttcaagtgaa
gtaaacccacctagtgacgaatcagattcttcatctgctccatcaaaagagcaactagag
caggagaaacaactgcttctttccttcaagccagtaatgcagaagttcctccatgaccat
gttgatctgcaagtgagtgctttatatgcgctccaggtgcactgctacaacagtaacttt
ccaaaaggcatgttactgcgcttctttgttcatttctatgatatggagatcattgaagaa
gaagcctttttagcatggaaagaagatattactcaagagtttccaggaaaaggcaaagct
ttattccaggtaaaccagtggctaacctggctggaaactgctgaagaagaagaatctgaa
gaagaagctgactaa

DBGET integrated database retrieval system