KEGG   Gallus gallus (chicken): 395909Help
Entry
395909            CDS       T01006                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A isoform 1 precursor
  KO
K05448  vascular endothelial growth factor A
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04370  VEGF signaling pathway
gga04510  Focal adhesion
gga04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395909 (VEGFA)
   04370 VEGF signaling pathway
    395909 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    395909 (VEGFA)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    395909 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    395909 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395909 (VEGFA)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   395909 (VEGFA)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   395909 (VEGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VEGF_C PDGF CXCXC DUF3408
Motif
Other DBs
NCBI-GeneID: 395909
NCBI-ProteinID: NP_990373
CGNC: 7830
Ensembl: ENSGALG00000010290
UniProt: P67964
Position
3
AA seq 216 aa AA seqDB search
MNFLLTWIHWGLAALLYLQSAELSKAAPALGDGERKPNEVIKFLEVYERSFCRTIETLVD
IFQEYPDEVEYIFRPSCVPLMRCAGCCGDEGLECVPVDVYNVTMEIARIKPHQSQHIAHM
SFLQHSKCDCRPKKDVKNKQEKKSKRGKGKGQKRKRKKGRYKPPSFHCEPCSERRKHLFV
QDPQTCKCSCKFTDSRCKSRQLELNERTCRCEKPRR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctcacttggatccactgggggctggcggcgctgctctatctgcagagc
gcggagttgtcgaaggctgctccggccctgggggatggggagcggaagcccaacgaagtt
atcaaattcctggaagtctacgaacgcagcttctgcaggacaattgagaccctggtggac
attttccaggagtaccctgatgaggtggagtacatattcaggccatcctgtgtgcctctg
atgagatgtgcgggttgctgcggcgatgagggcctagaatgtgtccctgtggatgtgtac
aacgtcacgatggagatcgcaagaattaaaccccatcagagtcagcacatagcgcacatg
agcttcttacagcacagtaaatgtgactgcagaccaaagaaagatgtcaaaaataaacaa
gaaaaaaaatcaaagcgaggaaaggggaagggtcaaaagagaaagcgcaagaaaggccgg
tacaaaccacccagctttcactgtgagccttgctcagagaggagaaagcacttgtttgta
caagatccccagacctgtaaatgttcctgcaaattcacagactcacgttgcaagtcgagg
cagcttgagttaaacgagcgcacttgcagatgtgaaaaaccgagacggtga

DBGET integrated database retrieval system