KEGG   Gallus gallus (chicken): 395916Help
Entry
395916            CDS       T01006                                 

Gene name
NME2
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga00240  Pyrimidine metabolism
gga00983  Drug metabolism - other enzymes
gga01100  Metabolic pathways
Module
gga_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
gga_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
gga_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    395916 (NME2)
   00240 Pyrimidine metabolism
    395916 (NME2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    395916 (NME2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    395916 (NME2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     395916 (NME2)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    395916 (NME2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 395916
NCBI-ProteinID: NP_990378
CGNC: 49549
Ensembl: ENSGALG00000002932
UniProt: O57535
Position
18
AA seq 153 aa AA seqDB search
MAANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFVHASEDLLKQHYIDLKDRP
FYPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHG
SDSVESAQKEISLWFKPAELIDYRSCAHDWVYE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaactgcgagcgcaccttcatcgccatcaagcccgacggcgtgcagcggggg
ctggtgggggagatcatcaaacgcttcgagcagaagggcttccgcctggtggccatgaag
ttcgtgcacgcctctgaagacctcctgaagcagcattacatcgacctgaaggatcggccc
ttctaccccggcctggtgaagtacatgaactccggccccgttgtggccatggtgtgggaa
gggctcaacgtggtgaaaacaggcagggtgatgctgggggaaaccaaccctgcagactca
aagcccggcaccatccgcggggatttctgcatccaagtgggaagaaacatcatccatggc
agcgactctgtagaaagcgcccagaaggagatcagcctttggttcaaaccagcagagctc
atcgactacagatcgtgtgcacatgactgggtctatgagtga

DBGET integrated database retrieval system