KEGG   Gallus gallus (chicken): 395922
Entry
395922            CDS       T01006                                 

Gene name
CENPC
Definition
(RefSeq) centromere protein C
  KO
K11497  centromere protein C
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    395922 (CENPC)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     395922 (CENPC)
    Mis6 complex
     395922 (CENPC)
SSDB
Motif
Pfam: CENP-C_C CENP_C_N Cupin_2
Other DBs
NCBI-GeneID: 395922
NCBI-ProteinID: NP_990382
CGNC: 8878
Ensembl: ENSGALG00000011683
UniProt: O57392
Position
4
AA seq 872 aa
MAERLDHLKKYYRARFCGQGGKKINIQPGQNVLKYIQDCFECDDTDVTINSPNATSSSTP
LVRNQERTSTQSPRPDAGLTIVVGNRTCHSTVSLPATPAETVRSKGEPCVFCPEPGRNSR
IADSIKTDSPVHRGETQVLTFKDVEGLCESPAKLSDPEDDPGVVGSPLLVEEAKTPVQTR
TVSIAPSSPSPVKDHNVEIESDCEFLIDESGCLSFKSWFSIPRKNRKSQKDGSAAPVLKS
QSSDKEKTADKKGKNMNVQAEVHSEQKTKNVRVQRDLKRTSESHPVSSDSEGKVLKSKMQ
SSTHAGKSKKDALKGSSKHRKKMSYESEAEQLMLSGLDSETSDGEQKIRRVMPREDLAVP
SAEHQQEQMLSSKKNLTPCKYQQSASKAYQRSVHKKQTKQTLANDTVLKSQRKKLKKSGK
RNGNKNPEPRRWKSSDSEPGEEGLEREPLESNEMFTSPPHQELQTSVLQKLAKSEKAEKV
LHALESVTDVNNKTPLKAVELLQHLVDSMKNSEKKRSSVTSSGKMLKKVHHRAHKRACSI
TRDSEPQNTTDSDSSSAPEVARKKRRQSAVRASKKPKSNRHQRLQHSPAAEKAMGPESGL
VLEHSEKYTSPSKHCEENNESSDNSEDLHCQIKNLLSDEIGRQKIVLPSNTPNVRRTKRI
RLKPLEYWRGERVTYTLKPSGRLLISGIAGAEAEPHMKNKLKSRHKKKRAKTRSEVVKCL
DIPLADASKPTSIVDPVTNQEVLLECINSGSSHSCFFEDESIKVYKSLNTSDFAAGKLIL
KPLKEKGHQFVHMDTIAFYVIRGQIITTLHKTSYYLTSGDYFYVPAGNGYNIRNLLNEES
VLHFTQLKNDRAPVGAELCSVTNENWSLEGKS
NT seq 2619 nt   +upstreamnt  +downstreamnt
atggcggagcgcttggatcacttaaaaaaatactaccgagcaagattctgcgggcaagga
ggaaagaagatcaatatacagcctggtcaaaatgtactgaaatacatacaggattgtttt
gaatgtgatgatactgatgtcacaattaactctccaaatgcaacctcttcctcaactcct
cttgtcagaaaccaggagaggacttcaacgcagagccctaggccagacgcagggttaact
atcgtggtaggaaatagaacctgtcattccacagtgtccttacctgcaacgccagcggag
acagtcaggagcaaaggggagccatgtgtgttctgcccagagcctggaagaaacagtcgc
atagctgattctatcaaaacagacagtcctgtgcatagaggagaaacacaggtgttaaca
ttcaaggatgttgaaggactatgtgaaagtcctgccaagttatcagatcctgaggatgat
cctggggtcgtgggatcacctcttcttgtggaggaagcaaaaactcctgtacaaacgcgt
acggtctcaatcgcaccatcatcaccttctcctgtcaaagatcacaacgtagaaatagaa
agcgattgtgagtttttaatcgatgaatcgggttgtctgtcttttaagtcttggttttca
ataccccgcaagaacagaaagtcacaaaaagatggctctgcagctcctgttttgaaatct
cagtcctctgacaaggaaaagacagcagataagaaaggcaagaacatgaatgtacaggct
gaagtacatagtgaacagaaaacgaagaatgtcagagtgcaacgtgacctgaaaagaacg
tcagaatcccatccggtctcttctgacagtgagggaaaggtccttaaatctaaaatgcaa
agcagtactcatgcaggaaaatctaaaaaggatgcacttaagggctcttccaagcataga
aagaagatgtcttatgaatcagaagctgaacaactgatgctgtctgggttggactcagaa
acatctgatggagaacaaaagataagaagggtgatgccaagggaggatttggcagtgccc
tcagctgagcatcagcaagagcagatgctatcttcaaaaaagaatctcactccttgcaag
taccagcagtctgcttcaaaagcttatcagcgttcagttcacaagaaacaaactaagcag
acacttgcaaatgatacggtgttgaagagccaaaggaagaagctgaaaaaatctggaaag
agaaatggtaataaaaatcctgaaccacggaggtggaagagttctgacagtgaacctggt
gaagaaggtcttgagagagagcctttagaatcaaatgagatgtttacctcacctccgcat
caggaattacagacttctgtgcttcagaagttggctaagtctgagaaagctgagaaagta
ctgcacgctttggaatcggttactgatgtaaataacaaaactcctttaaaagctgtagag
ttactgcagcatctcgtagacagtatgaagaattctgaaaagaaaagatcatcagttacg
tcttcagggaagatgctcaaaaaggttcatcacagagcccataaaagagcttgctcaatc
acgagggacagtgagcctcaaaatacaacagactctgacagctcttctgcaccagaggtg
gcgagaaagaaacgcagacaatcagctgtgagagcaagtaaaaaaccaaaaagtaacagg
caccagagactgcaacattcccctgcagctgagaaagctatgggtcctgaaagcgggctt
gttctagaacattctgagaaatatacttcgccaagtaagcactgtgaggagaataatgaa
tcttcagataattctgaggacctgcattgtcaaataaaaaatctactgtcagacgagata
ggcaggcaaaaaatagtgctgccttccaacacgcctaatgttcgtcggacaaaaaggata
cgacttaaacctctggaatattggcgaggagagcgggtaacctatacattgaagccttca
ggaaggcttttaattagtggaatagcaggtgcagaagcagaacctcacatgaagaataag
ctgaagagtcgtcataagaagaaaagagctaaaacaagaagtgaggtagtgaaatgtttg
gatatccccctggctgatgcttctaagccaaccagcatagtggacccagtaacaaatcag
gaagttcttctagagtgcattaactctggaagcagccactcatgtttcttcgaagatgaa
tcgataaaagtatataaaagtttgaacacgtctgattttgctgctggtaaattgatcttg
aaacctcttaaagaaaaaggccaccagtttgtccacatggatacaatagctttctatgtt
atccgtggccagattattaccaccttgcataagacatcgtattacctgacttcaggggat
tatttctacgttccagcaggaaatggatataacatacgtaatcttctgaatgaggaaagt
gttcttcatttcacacaactcaaaaatgacagggctcctgtgggtgcagagttgtgcagt
gtgacaaatgagaactggtcattggaaggaaaaagttga

DBGET integrated database retrieval system