KEGG   Gallus gallus (chicken): 395937
Entry
395937            CDS       T01006                                 

Gene name
TSHB
Definition
(RefSeq) thyrotropin subunit beta precursor
  KO
K05251  thyrotropin subunit beta
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    395937 (TSHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 395937
NCBI-ProteinID: NP_990394
CGNC: 1832
Ensembl: ENSGALG00000002550
UniProt: O57340 A5YW28
Position
26
AA seq 134 aa
MSPFFMMSLLFGLTFGQTASVCAPSEYTIHVEKRECAYCLAINTTICAGFCMTRDSNGKK
LLLKSALSQNVCTYKEMFYQTALIPGCPHHTIPYYSYPVAISCKCGKCNTDYSDCVHEKV
RTNYCTKPQKLCNM
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagtcccttcttcatgatgtctctcctctttggcctgacttttggtcaaacagcatca
gtttgtgctccttcagagtacacaatccacgtggagaagcgggagtgtgcctactgcctg
gccatcaacaccaccatctgcgctggattttgcatgacacgggacagcaacggcaagaag
ctgctactcaaaagtgctctgtctcaaaacgtgtgcacatacaaagagatgttctatcaa
acagcactgattccgggctgtcctcatcacaccatcccttactattcctaccccgtggcc
ataagctgcaagtgtggtaaatgcaacactgattacagtgactgtgttcacgagaaggtt
aggacaaactactgcaccaagccacagaagctctgtaacatgtga

DBGET integrated database retrieval system