KEGG   Gallus gallus (chicken): 395940Help
Entry
395940            CDS       T01006                                 

Gene name
DIO1
Definition
(RefSeq) type I iodothyronine deiodinase
  KO
K01562  type I thyroxine 5'-deiodinase [EC:1.21.99.4]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.99  With unknown physiological acceptors
    1.21.99.4  thyroxine 5'-deiodinase
     395940 (DIO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T4_deiodinase
Motif
Other DBs
NCBI-GeneID: 395940
NCBI-ProteinID: NP_001091083
CGNC: 8160
UniProt: O42411
Position
8
AA seq 246 aa AA seqDB search
MLSIRVLLHKLLILLQVTLSVVVGKTMMILFPDTTKRYILKLGEKSRMNQNPKFSYENWG
PTFFSFQYLLFVLKVKWRRLEDEAHEGRPAPNTPVVALNGEMQHLFSFMRDNRPLILNFG
SCTUPSFMLKFDEFNKLVKDFSSIADFLIIYIEEAHAVDGWAFRNNVVIKNHRSLEDRKT
AAQFLQQKNPLCPVVLDTMENLSSSKYAALPERLYILQAGNVIYKGGVGPWNYHPQEIRA
VLEKLK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttgagcatcagggtgctcctacacaaactcctgattcttttgcaggttactctgagt
gttgtcgttggtaaaaccatgatgatactcttccccgacaccacgaaaagatacatccta
aagctgggcgaaaagagcagaatgaaccagaacccaaagttcagctacgaaaactggggt
cccacttttttcagcttccagtatttgctctttgtgctgaaggtgaagtggaggaggctg
gaagacgaagcccacgagggacgccctgcccccaacacaccggtggtggctctgaatggg
gagatgcagcacctcttcagtttcatgcgagataaccgacctttaatcctcaattttgga
agctgcacctgaccttcatttatgttaaaatttgatgagttcaacaaacttgtcaaagat
ttcagctctatagcagatttccttatcatctacatcgaagaagctcacgcagtagatgga
tgggccttcagaaacaatgttgttattaaaaatcacagaagccttgaggatcgaaaaact
gcagcacaatttcttcagcagaagaaccccttatgtccagtggttttagacacaatggaa
aacctgagcagctcaaaatacgcagcgctgccagaaagactgtatatacttcaagcaggg
aatgtcatctacaagggaggagtggggccttggaattaccacccccaggaaatacgcgct
gtcctggaaaaactgaaatag

DBGET integrated database retrieval system