KEGG   Gallus gallus (chicken): 395942Help
Entry
395942            CDS       T01006                                 

Gene name
PAX7
Definition
(RefSeq) paired box protein Pax-7
  KO
K09381  paired box protein 3/7
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395942 (PAX7)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box plus homeo domain
    395942 (PAX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Homeodomain Pax7 Homeobox_KN HTH_32 HTH_23 HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 395942
NCBI-ProteinID: NP_990396
CGNC: 49563
Ensembl: ENSGALG00000043204
UniProt: O42349
Position
21
AA seq 524 aa AA seqDB search
MAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIV
EMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPRQVATPDVEKKIEE
YKRENPGMFSWEIRDRLLKDGHCDRSTVPSVSSISRVLRIKFGKKEEEEDCDKKEEDGEK
KAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYP
DIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQLAAFNHLLPGGFPPTGMPTLPP
YQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAAAAADSSSAYGARHSFSSYSD
SFMNAAAPANHMNPVSNGLSPQKQGAQNKMQCSRWNLTIALNNQVMSILSNPSGVPPQPQ
ADFSISPLHGGLDTTNSISASCSQRSDSIKSVDSLPTSQSYCPPTYSTTSYSVDPVAGYQ
YGQYGQTAVDYLTKNVSLSTQRRMKLGEHSAVLGLLPVETGQAY
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgctccccgggacggtaccgcggatgatgcgcccggcgccggggcagaactac
ccgcgcaccggcttccctttggaagtgtccaccccgctgggccagggccgggtgaaccaa
ctcggaggggttttcatcaacgggcgcccactgcccaaccacatccgccataagatcgtg
gagatggctcaccacggcatccggccctgcgtgatctccaggcagctgagggtctcccac
ggctgcgtttccaaaatcctctgcaggtaccaagagacgggctccatccggcccggggcc
atcgggggcagcaagcccaggcaggttgcgactcccgacgtggagaagaaaatcgaggaa
tacaagagggagaaccctgggatgttcagctgggagatccgggacaggctgctgaaggac
ggacactgcgaccgcagcactgtgccctcagtgagttcgattagccgtgtgctacgcatc
aaattcgggaagaaagaggaagaggaggactgcgacaagaaggaggaagacggggagaag
aaggccaagcacagcatagatggcatcctgggcgacaaagggaacaggctggatgaaggc
tccgatgtcgaatcagaaccagacctgcctttgaagaggaagcagcgccgcagccggacc
actttcactgccgagcagctggaggagctggagaaggcctttgagaggacccactacccg
gacatctacaccagggaggagctggcacagagaaccaagctcaccgaggcccgtgttcag
gtgtggttcagcaaccgacgagcaagatggcgcaagcaggcgggtgcaaaccaactcgca
gcattcaaccatctgctgccagggggattcccacccacgggaatgccaactctgcccccg
taccagctgccagactccacctacccaaccaccaccatttcccaagatggaggcagcacc
gtgcacagaccccagcccttgccaccatccaccatgcaccagggagggctcgctgccgcc
gctgcagccgactccagctctgcctatggggcccgacacagcttctccagctactcagac
agcttcatgaatgctgcagctcctgccaaccacatgaatcctgttagcaatggcctctct
ccgcagaagcagggtgcccaaaacaagatgcagtgctccaggtggaacctcaccatagcc
ttgaacaatcaggtgatgagcatcctgagcaaccccagcggggttcctccgcagccccag
gctgacttctccatctctcctcttcacggtggcctggacaccaccaactccatctctgcc
agctgcagccagcggagtgactccatcaagtccgtggacagcctcccgacctcgcagtcc
tactgtcctcccacctacagcaccaccagttacagcgtggacccggtggctggctaccag
tatgggcagtatggacaaactgctgttgattatttgaccaagaacgtgagcctgtccacg
cagcgcaggatgaagctgggagaacattcggccgttctggggctcctaccagtagagaca
ggccaagcttactga

DBGET integrated database retrieval system