KEGG   Gallus gallus (chicken): 395943
Entry
395943            CDS       T01006                                 

Gene name
PAX6
Definition
(RefSeq) paired box protein Pax-6
  KO
K08031  paired box protein 6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395943 (PAX6)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box plus homeo domain
    395943 (PAX6)
SSDB
Motif
Pfam: PAX Homeodomain HTH_32 HTH_Tnp_IS1 Homeobox_KN
Other DBs
NCBI-GeneID: 395943
NCBI-ProteinID: NP_990397
CGNC: 49564
Ensembl: ENSGALG00000012123
UniProt: O42348
Position
5
AA seq 436 aa
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNQ
NVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRL
LSEGVCTNDNIPSVSSINRVLRNLASEKQQMGADGMYDKLRMLNGQTGTWGTRPGWYPGT
SVPGQPAQDGCPQQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALE
KEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIP
ISSSFSTSVYQPIPQPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPP
VPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQ
VPGSEPDMSQYWPRLQ
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgcagaacagtcacagcggcgtgaaccagctcggcggggtgttcgtcaacgggaggccg
ctgcccgactccacgcggcagaagatcgtggaactcgcgcacagcggcgcgcggccgtgc
gacatctcccgaatcctgcagacccatgcagatgcaaaagtccaagtgctggacaatcaa
aacgtgtcgaatggatgtgtgagtaaaattttgggcaggtattacgaaactggctccatc
aggcccagggcgatcggaggtagtaagccgagagtagcgactcccgaagttgtaagcaaa
atagcgcagtataaacgagagtgcccctccatctttgcgtgggagattcgagacagatta
ctctcggagggggtctgtaccaacgataacatacccagtgtgtcgtcgataaacagagtc
ctccgcaacctggctagcgaaaagcaacagatgggtgccgacgggatgtacgacaagcta
aggatgctgaacgggcagacggggacatggggcacccggcccggctggtatcccggcacc
tcggtacccgggcagcccgcacaagacggctgcccgcagcaggagggaggaggggagaac
accaactccatcagctccaatggggaagattccgatgaggcccagatgagacttcagctg
aaaaggaagctgcagagaaataggacatcctttacccaagagcaaatcgaagcccttgag
aaagagtttgagagaacccactatcctgatgtgtttgcgagagagcgactagctgctaaa
atagacttgcctgaagcaaggatacaggtgtggttttctaacagaagggccaagtggaga
agggaggagaagctgcggaaccagcggagacaagccagcaacactcccagccacatcccc
atcagcagtagtttcagcacaagcgtttaccagccgatcccacagccgaccacccccgtt
tcctctttcacatcaggttccatgttgggcaggacagacacagcgctcacgaacacgtac
agcgcactgccgcccatgcccagcttcaccatggccaacaacctgcctatgcaacccccg
gtacccagccagacctcctcctactcttgcatgctgcccaccagcccgtcggtgaatggc
cggagctatgacacctacacccctccgcacatgcagacacacatgaatagccagcccatg
ggcacctctggcaccacttccacaggtctcatttcccctggagtgtcagttccagttcaa
gttcctggcagtgaacctgacatgtctcagtattggccaagattacagtaa

DBGET integrated database retrieval system