KEGG   Gallus gallus (chicken): 395950
Entry
395950            CDS       T01006                                 

Gene name
GBX2
Definition
(RefSeq) homeobox protein GBX-2
  KO
K09321  homeobox protein GBX
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395950 (GBX2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Eve
    395950 (GBX2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 395950
NCBI-ProteinID: NP_990399
CGNC: 10048
UniProt: O42230
Position
7
AA seq 340 aa
MSAAFQPSLMMMQRPLGSSTAFSIDSLIGSPPPPAPGHFVYTGYPMFMPYRPVVLPPPPP
ALPQAALQPPLPPAPPPPLPALPGAFCPGLAQGMALTSTLMAALPGSFPASPPRPEAARK
FAPPGNFDKADGLPPPDGGGGGGDDGKTGGGLLPFPAADAVHASLAGALRGGPKDDPKAE
EEAKGREENFSMDSDLDYSSDENGPAPAAPREEDCGTALEENPPSAANAAANAAATGKNR
RRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAG
NASSKAGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagcgcggctttccagccctcgctgatgatgatgcagcgcccgctgggaagcagcacg
gccttcagcatcgattcgctcatcggcagccccccgccgcccgcccccggccacttcgtc
tacaccggctaccccatgttcatgccgtaccggcccgtcgtgctgccccccccgccgccc
gccctgccgcaggccgccctgcagccgccgctgccccccgcgccgcccccgccgctgccc
gcgttgcccggagccttctgccccgggctggcgcagggcatggccctcacctccacgctg
atggccgcgctgcccggctccttccccgcctccccgccgcgccccgaggccgccaggaag
ttcgcccccccggggaacttcgacaaggccgacggactgcctcccccggacggcggcggc
ggcggcggagacgacggcaaaaccgggggggggctgctacccttccccgctgccgacgcc
gtgcacgcatcgctggccggggccctccgcggcggccccaaagacgatcccaaagcggag
gaggaggcgaagggccgcgaggagaacttctccatggacagcgacctcgactacagctcc
gacgagaacggccccgcgccggcggccccgcgggaggaggactgtggcaccgcgttggag
gagaacccccccagcgccgccaacgccgccgccaacgccgcggccacggggaagaaccga
cggcggcggacggcgttcaccagcgagcagctgctggagctggagaaggagttccactgc
aagaagtacctctcgctgacggagcgctcgcagatcgcgcacgccctgaagctgagcgag
gtgcaggtgaagatctggttccagaacaggcgagccaaatggaagcgggtgaaggcgggc
aacgccagctccaaggcgggggaaccgtcgcggaaccccaagatcgtcgtgcccatcccc
gtgcacgtcagccgcttcgccatcaggagtcagcaccagcagctggagcaggcgcggccc
tga

DBGET integrated database retrieval system