KEGG   Gallus gallus (chicken): 395954
Entry
395954            CDS       T01006                                 

Gene name
MATN3
Definition
(RefSeq) matrilin-3 precursor
  KO
K19467  matrilin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    395954 (MATN3)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 Von Willebrand domain-containing proteins
  VWA domain-containing proteins
   395954 (MATN3)
SSDB
Motif
Pfam: VWA FXa_inhibition EGF_CA cEGF VWA_2 Matrilin_ccoil EGF EGF_3 Copine Plasmod_Pvs28
Other DBs
NCBI-GeneID: 395954
NCBI-ProteinID: NP_990403
CGNC: 12338
Ensembl: ENSGALG00000016478
UniProt: O42401
Position
3
AA seq 452 aa
MRRALGTLGCCLALLLPLLPAARGVPHRHRRQPLGSGLGRHGAADTACKNRPLDLVFIID
SSRSVRPEEFEKVKIFLSKMIDTLDVGERTTRVAVMNYASTVKVEFPLRTYFDKASMKEA
VSRIQPLSAGTMTGLAIQAAMDEVFTEEMGTRPANFNIPKVVIIVTDGRPQDQVENVAAN
ARTAGIEIYAVGVGRADMQSLRIMASEPLDEHVFYVETYGVIEKLTSKFRETFCAANTCA
LGTHDCEQVCVSNDGSYLCDCYEGYTLNPDKRTCSAVDVCAPGRHECDQICVSNNGSYVC
ECFEGYTLNPDKKTCSAMDVCAPGRHDCAQVCRRNGGSYSCDCFEGFTLNPDKKTCSAVD
VCAPGRHDCEQVCVRDDLFYTCDCYQGYVLNPDKKTCSRATTSSLVTDEEACKCEAIAAL
QDSVTSRLEALSTKLDEVSQKLQAYQDRQQVV
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcggcgggcgctcggaacgctgggctgctgcctggcgctgctcctcccgctgctgccc
gcggcgcgcggggtcccgcaccgccatcgccggcagccgctgggcagcggcctggggagg
cacggagcggcagacactgcctgcaagaaccgtcccctcgacctcgtcttcatcatcgac
agctcccgcagcgtccgacctgaagagtttgagaaagtgaaaatctttctgtcaaaaatg
atcgatactctggatgttggtgaaagaacaacccgcgtggcagtcatgaattacgccagc
accgtcaaggtagagtttcccctccggacctactttgataaagcctccatgaaggaggcc
gtgtctcgcattcagcccctgtctgctggcaccatgactggccttgccatccaagctgcc
atggacgaagtcttcactgaggagatgggtacccggccagccaacttcaatatccccaag
gtggtcattattgtgacagatggacggccacaagaccaggttgaaaacgtggcagcaaac
gcccgcacggctggcattgagatctacgcagtgggggtaggccgtgctgacatgcagtcc
ctgaggataatggccagcgagccgctggatgaacacgtcttttatgtggagacctacggt
gtgatcgagaagctgacatccaagttccgagagacgttctgtgctgcaaatacatgtgca
cttgggacccatgactgtgagcaggtctgcgtgagtaacgatggatcctacctctgtgat
tgctatgaaggctacactctgaatccagataagagaacttgctcagctgtggatgtgtgt
gcacctgggaggcatgaatgcgatcagatctgtgtgagtaacaacggatcctatgtctgt
gaatgctttgaaggctacaccctgaatccagataagaagacttgctcagccatggacgtg
tgtgcacctggaaggcatgattgtgcccaagtctgtcggagaaacggtggatcttacagc
tgtgactgctttgagggattcactctgaatccagacaagaagacttgctcagccgttgat
gtgtgtgcacctggaaggcacgactgtgagcaggtctgtgtgagagatgatctgttctat
acatgcgattgctatcaaggctacgtcctgaatccagacaagaagacttgctcaagagcc
acaacaagcagtcttgtgacagatgaagaggcctgtaagtgtgaagccatagctgcattg
caggattcagtcacctcacgcctcgaagctctgtccacaaaactagatgaagtgtctcag
aagctgcaagcctatcaagacagacagcaggttgtctga

DBGET integrated database retrieval system