KEGG   Gallus gallus (chicken): 395958
Entry
395958            CDS       T01006                                 

Gene name
UBA52
Definition
(RefSeq) ubiquitin-60S ribosomal protein L40
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
gga  Gallus gallus (chicken)
Pathway
gga03010  Ribosome
gga04120  Ubiquitin mediated proteolysis
gga04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    395958 (UBA52)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    395958 (UBA52)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    395958 (UBA52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gga03011]
    395958 (UBA52)
   04121 Ubiquitin system [BR:gga04121]
    395958 (UBA52)
Ribosome [BR:gga03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    395958 (UBA52)
  Archaea
    395958 (UBA52)
Ubiquitin system [BR:gga04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   395958 (UBA52)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 395958
NCBI-ProteinID: NP_990406
CGNC: 49574
Ensembl: ENSGALG00000037716
UniProt: O42388
Position
28
AA seq 128 aa
MQIFVKTLTGKTITLEVEPNDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcagatctttgtgaagacgctgacgggcaaaaccatcaccttggaggtggagcccaat
gacaccatcgagaacgtgaaggccaagatccaggacaaggaagggatcccccccgaccag
cagcgcctgatctttgcggggaagcagctggaggatggccgcacgctcgccgactacaac
atccagaaagagtccaccctgcacctggtgctgcgtctgcgcgggggtatcattgagccc
tccctgcggcagttggcccagaagtacaactgcgataagatgatctgccgcaagtgctac
gcccgcctccatccccgtgccgtcaactgccgcaagaagaagtgcggccacaccaacaac
ctgcgccccaagaagaaggtcaaatag

DBGET integrated database retrieval system