KEGG   Gallus gallus (chicken): 395959Help
Entry
395959            CDS       T01006                                 

Gene name
NEUROD4
Definition
(RefSeq) neurogenic differentiation factor 4
  KO
K09079  neurogenic differentiation factor 4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395959 (NEUROD4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    395959 (NEUROD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neuro_bHLH HLH CCDC106
Motif
Other DBs
NCBI-GeneID: 395959
NCBI-ProteinID: NP_990407
CGNC: 49575
Ensembl: ENSGALG00000034306
UniProt: P79766
Position
33
AA seq 330 aa AA seqDB search
MTKTYTKAKEMAELVGTQGWMDDALSSKDELKAENGRPGPFGLVAGLNEEHDSIEEEEEE
EDDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKT
QKLSKIETLRLARNYIWALSEVLETGQTPEGKSFVEMLCKGLSQPTSNLVAGCLQLGPQT
LFLEKHEEKTPGCESAISSHSFTYQSPGLPSPPYGSMETHLLHLKPPAFKSLVDASFGNP
PDCTTPPYEGPLTPPLSISGNFSLKQDGSPDLDKPYAFMAHYPSVSLAGAHGHPTHFQNA
VPRYEIPIDMSYESYPHHVAGPQLNAIFNE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagacgtacaccaaagccaaggagatggcagagctggtgggcacccagggctgg
atggacgacgcgctgagctccaaggatgagctgaaggcagagaacggcaggccaggacct
ttcgggttggtggcgggcttgaacgaagagcacgacagcatcgaggaggaagaggaggaa
gaggatgatggggagaagccgaagagaagagggccgaagaagaagaagatgaccaaggcc
aggttggagaggttcagggctcggcgggtgaaagccaacgctcgggagcgcacgcggatg
cacggactgaacgatgccctggacaacctgaggagggtgatgccctgctactccaaaaca
cagaagctgtccaagatcgagacgttgaggttggcgaggaattacatctgggctctgtcc
gaggtgctcgaaacggggcagaccccggaagggaagagcttcgtggagatgctctgcaaa
gggttatcccagcccaccagcaacctggtggccggctgcctgcagctggggccgcagacc
ttattcctggagaagcacgaggagaaaaccccgggctgcgagtcggccatttccagccac
tccttcacctaccagtccccggggctgcccagcccgccctacggctccatggaaacccac
ctgctgcacctcaagccccccgccttcaagagtttggtggatgcttcttttgggaacccc
cccgactgcaccactcccccatacgagggtcccctcacgccgcccctgagcatcagtggg
aacttctctttgaagcaggatggctctccagacctggataagccctacgccttcatggct
cactacccttcggtcagcctggccggggcacatggacatcccacccacttccaaaacgca
gtgccccgttatgagatccccatagacatgagctacgagtcctaccctcaccacgtggcc
gggcctcagctcaacgccatcttcaacgagtag

DBGET integrated database retrieval system