KEGG   Gallus gallus (chicken): 395979Help
Entry
395979            CDS       T01006                                 

Gene name
ADH6
Definition
(RefSeq) alcohol dehydrogenase 6
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00010  Glycolysis / Gluconeogenesis
gga00071  Fatty acid degradation
gga00350  Tyrosine metabolism
gga00830  Retinol metabolism
gga00980  Metabolism of xenobiotics by cytochrome P450
gga00982  Drug metabolism - cytochrome P450
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    395979 (ADH6)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    395979 (ADH6)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    395979 (ADH6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    395979 (ADH6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    395979 (ADH6)
   00982 Drug metabolism - cytochrome P450
    395979 (ADH6)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     395979 (ADH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N UDPG_MGDP_dh_N TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 395979
NCBI-ProteinID: NP_990423
CGNC: 49588
Ensembl: ENSGALG00000020160
UniProt: O42483
Position
4
AA seq 376 aa AA seqDB search
MATSGKVIRCRAAVAWAAGKSLSVEEIEVAPPKAREVRVKMVATGICHTDEHVLEGNFPD
VDFPVILGHEGAGIVESIGEGVTSVKPGDKVILFPLPQCGECSFCLNPDSNYCLKSHLTE
PQNLMPDKTTRFTCKGKQIQHFLWNSTFAEYTVVPEYTLAKIDAAAPLDKVCVFACGFST
GYGAAVNTAKVKLGSTCAVFGLGGVGLSVVMGCKAAGASRIIAIDINKDKFAKAKEMGAT
ECINPQDFKKPIQQVLTEMTGHGVDYSFEAIGTADTLIAALASCNMNTGVCVMVGVLPAG
STVPIDPFLLLSGRTCKGTLAGGWKMRDSIPKLVASYLEKKFNSDLLITHTLPFAKINEG
FELLRAGKSIRTVMLF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccacttctggaaaagttatccgatgcagagctgcagttgcctgggcagcgggcaaa
tcactctctgttgaggagatagaggttgcacctccaaaggcacgtgaagtgcgtgtcaag
atggtggccacggggatctgccacacagatgaacatgttctagaaggtaactttcctgac
gtagatttcccagtcatcctaggccacgaaggagctgggattgtggagagcattggagaa
ggagtgacctccgtgaagccaggagacaaagtcatcctctttccacttcctcagtgtgga
gaatgcagcttctgcttgaatcctgactccaactactgcctgaaatcacacctcactgaa
ccacaaaacctgatgcctgacaagaccaccaggttcacttgcaaagggaaacagatccaa
cacttcctctggaacagcacttttgcggaatacactgttgtacctgagtacaccctggcc
aagatagatgctgctgcacctctggacaaagtctgtgtgtttgcctgtggtttctccaca
ggctatggggctgctgtcaacaccgccaaggtaaaactgggctccacctgtgccgtcttt
ggccttggaggagtcggcctctctgttgtcatgggctgcaaggcagctggagcgtcccgc
atcattgccatcgatatcaacaaggacaagtttgccaaggccaaagagatgggagccacc
gagtgcatcaaccctcaggacttcaagaagcctatccagcaggtgctcaccgagatgacc
ggtcacggcgtggactactcctttgaagccattgggaccgcagataccctgattgctgcc
ctggcctcttgcaatatgaacaccggggtctgtgtgatggttggagtattacctgctggt
tcgacagttcccattgatcctttccttctactaagtgggcgcacctgtaaaggaaccctg
gctggaggctggaaaatgagagactctatccccaaattagttgccagctatttggagaag
aaatttaactctgacttgctgatcacacacacgctgccgtttgctaaaatcaacgaggga
tttgaattgctacgtgcaggcaaaagcattcgcaccgtgatgctcttctga

DBGET integrated database retrieval system