KEGG   Gallus gallus (chicken): 395982
Entry
395982            CDS       T01006                                 

Gene name
TFAP2A
Definition
(RefSeq) transcription factor AP-2-alpha
  KO
K09176  transcription factor AP-2 alpha/beta
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395982 (TFAP2A)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Other basic domains
   AP-2 (bHSH)
    395982 (TFAP2A)
SSDB
Motif
Pfam: TF_AP-2
Other DBs
NCBI-GeneID: 395982
NCBI-ProteinID: NP_990425
CGNC: 9685
Ensembl: ENSGALG00000012775
UniProt: O13111
Position
2
AA seq 437 aa
MLWKLTDNIKYEECEERHDSASNGTARLPQLGAVGQSPYSSAPPLSHTPNADFQPPYFPP
PYQPIYPQSQDPYSHVNDPYSLNSLHTQPQPQHPAWPGQRQSQEPSLLHAHRGLPHQLGG
LDPRRDYRRHDDLLHGPHGLGAGLADLPLHSIPHAIEDVPHVDDPGINIPDQTVIKKGPV
SLSKSNNNAVSSIPINKDALFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSP
PECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHL
ARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLG
NSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNS
HTDNSTKSSDKEEKHRK
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctctggaagctgacggataacatcaagtacgaggagtgcgaggagcgccacgacagt
gccagcaacgggacggcgcggctgccccagctgggggccgtggggcagtccccgtatagc
agcgccccgccgctctcgcacacccccaacgccgacttccagccgccctacttccccccc
ccgtaccagcccatctacccccagtctcaggacccctactcccacgtcaacgacccctac
agcctcaactccctgcacacccagccgcagccccagcacccggcgtggccgggccagagg
cagagccaggagccgagcttgctgcacgcgcaccgggggctgccccaccagctggggggg
ttggacccccgccgcgactaccggcggcacgacgacctgctgcacggcccgcacgggctg
ggagcggggctggccgacctgccgctgcactccatccctcacgccatcgaggacgtgccg
cacgtagacgaccccggcatcaacatcccggaccagaccgtcattaagaaaggccccgtg
tccctctccaagtctaacaacaacgccgtctcctccatccccatcaacaaggacgcgctc
ttcggcggggtggtgaaccccaacgaggtcttctgctcggtgccgggccgcctctcgctg
ctcagctccacctccaagtacaaggtcacggtggcggaagtgcagcgacgcctctcgccg
cccgagtgcctcaacgcctccctgctgggcggagtgctgaggagggcaaagtccaaaaat
ggcgggaggtccctccgagagaagctggacaagatagggttgaacctgccggccgggagg
cgcaaagctgctaatgtcaccttgctcacctcgctggtggagggggaagcagtgcatcta
gctagagattttgggtacgtttgtgagacagaatttcctgccaaagcagtagctgaattt
ctcaaccgacaacattccgatccaaacgagcaagtcacaagaaaaaacatgcttctagct
acaaaacagatctgtaaagagttcaccgacctgctggctcaggaccgatctcccctgggg
aactcgcggcccaaccccattttggagccgggcatccagagctgcctgacccacttcaac
ctcatctcgcacggcttcgggagcccggcggtatgcgctgccgtcaccgccctgcagaac
tatctcaccgaggcgctcaaggccatggacaaaatgtacctcagcaacaaccccaacagc
cacacagacaacagcaccaaaagcagcgacaaagaggagaagcaccgaaagtga

DBGET integrated database retrieval system