KEGG   Gallus gallus (chicken): 395983Help
Entry
395983            CDS       T01006                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04068  FoxO signaling pathway
gga04137  Mitophagy - animal
gga04140  Autophagy - animal
gga04141  Protein processing in endoplasmic reticulum
gga04210  Apoptosis
gga04217  Necroptosis
gga04310  Wnt signaling pathway
gga04510  Focal adhesion
gga04530  Tight junction
gga04620  Toll-like receptor signaling pathway
gga04621  NOD-like receptor signaling pathway
gga04622  RIG-I-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04920  Adipocytokine signaling pathway
gga04933  AGE-RAGE signaling pathway in diabetic complications
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    395983 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395983 (MAPK9)
   04012 ErbB signaling pathway
    395983 (MAPK9)
   04310 Wnt signaling pathway
    395983 (MAPK9)
   04068 FoxO signaling pathway
    395983 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    395983 (MAPK9)
   04137 Mitophagy - animal
    395983 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    395983 (MAPK9)
   04217 Necroptosis
    395983 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    395983 (MAPK9)
   04530 Tight junction
    395983 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    395983 (MAPK9)
   04621 NOD-like receptor signaling pathway
    395983 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    395983 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    395983 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    395983 (MAPK9)
   04920 Adipocytokine signaling pathway
    395983 (MAPK9)
   04912 GnRH signaling pathway
    395983 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    395983 (MAPK9)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    395983 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    395983 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    395983 (MAPK9)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     395983 (MAPK9)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   395983 (MAPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Kinase-like FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 395983
NCBI-ProteinID: NP_990426
CGNC: 49590
Ensembl: ENSGALG00000039099
UniProt: P79996
Position
13
AA seq 382 aa AA seqDB search
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESDRDKLKTSQARDLLSK
MLVVDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSAQMQQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagtaaatgcgatagtcagttttacagtgttcaagttgcagattcaacattc
actgtactaaaacgctaccagcaattgaagcccataggatcaggggcacagggcattgtt
tgtgctgcgttcgatacagtccttgggataaacgttgctgtaaagaagttgagtcgtcct
tttcagaatcaaacccacgcaaaaagagcttacagagagcttgttcttttaaaatgtgtc
aatcacaaaaatataattagtttattaaacgtatttacaccgcagaagtcactagaagaa
tttcaggatgtatatttggttatggaactgatggatgccaacttgtgccaagttattcat
atggaattggatcatgaacgaatgtcttatctcctttaccagatgctatgtggtatcaaa
catctccactcagctggtatcatccacagagatttgaaacccagcaacatagtagtaaaa
tcagattgtacactcaaaatccttgattttggactggcaagaacagcgtgtactaatttt
atgatgacgccatatgtagtaacacgatattacagagcgccagaggttatccttggaatg
ggatataaagagaatgttgatatctggtcagttggttgcatcatgggagaattggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcaatggaataaagtaattgagcaa
ctaggaacgccctcagcagaattcatgaagaaactacagcctacagtgaggaattatgta
gaaaacaggccaaaatatccaggtattaaatttgaagagctcttcccagactggatattt
ccatcagaatctgaccgtgacaagttaaaaaccagtcaagctagagatttattatcaaag
atgctcgtagtagatccagacaagagaatttccgtagatgaggccttacgtcatccctat
attacggtctggtatgatccagctgaagcagaagctcctccacctcaaatttatgatgca
caactggaagagagagaacatgcaattgaagaatggaaagaattaatatacaaagaagta
atggattgggaagaaagaagcaagaatggtgtggtaaaagatcagccctcagcacagatg
cagcagtga

DBGET integrated database retrieval system