KEGG   Gallus gallus (chicken): 395995
Entry
395995            CDS       T01006                                 

Gene name
TBP
Definition
(RefSeq) TATA-box-binding protein
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
gga  Gallus gallus (chicken)
Pathway
gga03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    395995 (TBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395995 (TBP)
   03021 Transcription machinery [BR:gga03021]
    395995 (TBP)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    395995 (TBP)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     395995 (TBP)
  RNA polymerase III system
    TFIIIB
     395995 (TBP)
  RNA polymerase I system
    SL1/TIF-1B
     395995 (TBP)
SSDB
Motif
Pfam: TBP DUF3378
Other DBs
NCBI-GeneID: 395995
NCBI-ProteinID: NP_990434
CGNC: 8484
Ensembl: ENSGALG00000011171
UniProt: O13270
Position
3
AA seq 302 aa
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPVQSTNSLSILEEQQRQQQ
QQQAAQSSTSQQATQGTSGQTPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASE
SSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSG
KMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTH
QQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
TT
NT seq 909 nt   +upstreamnt  +downstreamnt
atggatcagaacaacagcttgccgccctacgctcaaggcctagcctcccctcagggtgca
atgactcctggaattccaatttttagcccgatgatgccgtatggcacaggactgactcca
cagcctgtccagagcaccaacagtctgtccattcttgaggaacagcaacggcagcagcag
cagcaacaggcagcgcagagttctacatcacagcaagcgacacagggaacatctggtcaa
actccccagctcttccactcacagactcttaccacagcccctttgccgggaaccacacct
ctgtacccgtccccaatgactccaatgactcctataactcctgcgacaccggcatctgag
agctctgggatagtgccacagctacagaatattgtgtccacggtgaatcttggttgcaaa
cttgacctaaaaaccattgcacttcgtgcccgaaatgctgaatataatcccaagcgtttt
gctgctgttattatgaggataagagaaccacgtactactgcgcttatattcagctctgga
aaaatggtgtgcacaggagcaaaaagcgaggaacagtccagactggcagcaaggaagtac
gcaagagttgttcagaaactgggttttcctgcaaaatttttggattttaaaattcagaac
atggtgggcagctgtgatgtgaaatttcctatcagattagaaggattggtactcacacac
cagcagttcagcagctatgagccagaattgtttcctggcttaatctacagaatgatcaag
ccaagaattgttctgcttatttttgtttctggaaaagtggttttaactggtgctaaagtt
cgagcagaaatctacgaagcgtttgaaaacatctatcctattttaaaggggttccggaag
acaacgtaa

DBGET integrated database retrieval system