KEGG   Gallus gallus (chicken): 395997Help
Entry
395997            CDS       T01006                                 

Gene name
EPHA5
Definition
(RefSeq) ephrin type-A receptor 5 precursor
  KO
K05106  Eph receptor A5 [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    395997 (EPHA5)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     395997 (EPHA5)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   395997 (EPHA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Pur_ac_phosph_N Ephrin_rec_like HNH_5 Haspin_kinase DUF4998 Kdo Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 395997
NCBI-ProteinID: NP_990436
CGNC: 8875
Ensembl: ENSGALG00000011680
UniProt: F1NSE6
Position
4
AA seq 1013 aa AA seqDB search
MGLRGGGGRAGRPAPGWTCLLLCAALRSLLASPGSEVNLLDSRTVMGDLGWIAYPKNGWE
EIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIELKFTLRDCNSLPGGL
GTCKETFNMYYFESDDEDGRNIRENQYIKIDTIAADESFTELDLGDRVMKLNTEVRDVGP
LTKKGFYLAFQDVGACIALVSVRVYYKKCPSVIRNLARFPDTITGADSSQLLEVSGVCVN
HSVTDEAPKMHCSAEGEWLVPIGKCLCKAGYEEKNNTCQVCRPGFFKASPHSPSCSKCPP
HSYTLDEASTSCLCEEHYFRRESDPPTMACTRPPSAPRSAISNVNETSVFLEWIPPADTG
GRKDVSYYIACKKCNSHSGLCEACGSHVRYLPQQTGLKNTSVMMVDLLAHTNYTFEIEAV
NGVSDQNPGARQFVSVNVTTNQAAPSPVSSVKKGKITKNSISLSWQEPDRPNGIILEYEI
KYFEKDQETSYTIIKSKETAITADGLKPGSAYVFQIRARTAAGYGGFSRRFEFETSPVLA
ASSDQSQIPIIVVSVTVGVILLAVVIGFLLSGSCCDHGCGWASSLRAVAYPSLIWRCGYS
KAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAKEIEASCITIERVIGAG
EFGEVCSGRLKLQGKREFPVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLEGVVT
KSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAAR
NILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAFRKFTSASDVWSY
GIVMWEVMSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQLMLDCWQKDRNSRPK
FDEIVSMLDKLIRNPSSLKTLVNASSRVSNLLVEHSPVGSGAYRSVGEWLEAIKMGRYTE
IFMENGYSSMDSVAQVTLEDLRRLGVTLVGHQKKIMNSLQEMKVQLVNGMVPL
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcggggcggtggcggccgtgccgggaggccggctcccggctggacgtgcctg
ctgctgtgcgccgcgctccggagcctgctggccagcccgggcagcgaggtgaatttactg
gactcacgcacagtaatgggggatctaggatggatagcctacccaaaaaatgggtgggaa
gaaattggtgaggtggatgaaaactatgctccgatacacacataccaagtatgcaaggta
atggaacagaatcagaacaactggcttctgaccagctggatctctaatgaaggggcatcc
cgcatcttcattgaactcaaattcaccctgagggactgtaacagccttccaggaggactt
gggacttgcaaggagacttttaacatgtactactttgagtcagatgatgaagatgggagg
aacatcagagagaatcagtacatcaagatagataccattgctgctgatgagagcttcacg
gagttggacctcggcgacagagttatgaagttaaacacagaagtgagagatgttgggcct
ctaacaaaaaaaggattttaccttgcttttcaggatgtgggcgcctgcattgccctggtc
tctgtgcgtgtgtactacaagaaatgcccatcagtgatccgcaacctggcacgctttcca
gataccatcacaggagcagattcctcacagctgctagaagtgtcaggcgtctgtgtcaac
cactcagtgactgatgaggcaccaaagatgcactgcagtgctgagggagaatggctggtg
cccatcgggaagtgtttgtgcaaggcagggtacgaggagaagaacaacacctgccaagta
tgcagacctgggttcttcaaagcttcaccccacagtccatcctgcagcaaatgtccccct
cacagctacacgcttgatgaagcatccacatcttgcctgtgtgaagagcactattttagg
agagaatcagacccacctacaatggcctgtacaagacccccctctgctcctcggagtgcc
atctcaaatgttaacgagactagtgtctttctggaatggattccccctgctgatactggt
ggaaggaaagatgtgtcttattatattgcatgcaagaagtgcaactcacactcaggtctg
tgcgaggcatgtggcagtcatgtcaggtacctcccccagcaaaccggcctgaaaaacacc
tctgtcatgatggtggatctgcttgctcatacaaactatacctttgaaattgaggcagtg
aatggagtgtccgaccagaaccctggagcccggcagtttgtgtctgtaaatgtaaccaca
aaccaggcagcaccttctccagtcagtagtgtgaaaaaagggaagataactaaaaatagc
atctccctttcctggcaggagccagatcgacccaacggcatcatcctggaatacgaaatc
aaatattttgaaaaggaccaggagacaagctacaccatcatcaaatccaaagagaccgca
attacggcagatggcttgaaaccaggctcagcgtacgtcttccagatccgagcccggaca
gctgctggctacggtggcttcagtcgaagatttgagtttgaaaccagcccagtgttagct
gcatccagtgaccagagccagattcctataattgttgtgtctgtaacagtgggagttatt
ctgctggctgttgttatcggtttccttctcagtggaagttgctgcgatcatggctgtggg
tgggcttcttctctgcgtgctgttgcctatccgagcctaatatggcgctgtggctacagc
aaggctaaacaagacccagaagaagaaaagatgcattttcataatggccacattaaactg
cctggtgtaagaacctacattgatccccacacctatgaggaccctaatcaagctgtccac
gagtttgccaaggaaatagaagcttcgtgcataaccatcgagagagttatcggagctggt
gaatttggagaagtctgcagtggacggctgaaactgcagggaaaacgcgagtttccagtg
gctatcaaaaccctgaaggtgggctacacagagaagcaaaggcgagatttcctgggagaa
gcgagcatcatggggcagttcgaccaccccaacatcatccacctggaaggtgtcgtcaca
aaaagcaaacctgtaatgatagtaacggaatacatggaaaatggttctctggatacattt
ttaaagaagaacgatgggcagttcacggtcattcagctggtcgggatgctgcgaggcatc
gcatcagggatgaagtacctgtctgacatgggttacgtacacagagacctcgctgccagg
aatatcctcatcaacagcaacttagtctgcaaggtgtctgactttggcctctccagagtc
ctagaagatgatcctgaagcagcgtacacaaccaggggagggaagatccccatccgatgg
acggcacctgaagcaatcgccttccgcaaattcacgtcggccagcgatgtgtggagctac
ggcattgtgatgtgggaagtgatgtcctatggcgagagaccttactgggaaatgacaaac
caagatgtgattaaagccgtggaggaaggctatcgcctgccaagtcccatggactgccct
gctgctctctaccagttgatgcttgactgctggcagaaagaccgcaacagcaggcccaag
tttgatgaaattgtcagcatgttggacaagctcatccgtaacccaagcagcttgaagacg
ttggttaatgcatcgagcagagtatcaaatttgttggtagaacacagtccagtggggagc
ggtgcctacaggtcagtgggtgagtggctggaagccatcaaaatgggtcgatacaccgag
attttcatggagaatggatacagttcgatggattctgtggctcaggtgaccctagaggat
ttgaggcggctgggagtgacacttgttggtcaccagaagaagataatgaacagccttcaa
gagatgaaggtccagttggtgaatgggatggtgccattgtaa

DBGET integrated database retrieval system