KEGG   Gallus gallus (chicken): 396045Help
Entry
396045            CDS       T01006                                 

Gene name
GLI1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04340  Hedgehog signaling pathway
Module
gga_M00678  Hedgehog signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    396045 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396045 (GLI1)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    396045 (GLI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Motif
Other DBs
NCBI-GeneID: 396045
NCBI-ProteinID: NP_001292174
CGNC: 10848
Ensembl: ENSGALG00000042422
AA seq 1281 aa AA seqDB search
MFNPVTPQAPGYAEHCCPRPLHGASAGTPGLQGLDFPVCHQPNLASSHHGYGLVPGTEHP
GGAADGSRFSTPRGAGKLGKKRALSISPLSDSSVDLQTVIRTSPNSLVAFINSRCASAGG
SYGHLSISTISPSLGYQNPPGQQKGQGQLFSHTPPLPPCSSHETLSSRPGLLHPTPARGT
IKHCQQLKLERSLSSPLTAKYPEEKSEGDISSPASTGTQDPLLGMLSVRDDLEKEDGKPE
SETIYETNCYWDGCAKEFDTQEQLVHHINNEHIHGEKKEFVCHWAACSREQRPFKAQYML
VVHMRRHTGEKPHKCTFEGCNKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDR
AKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKHRGSVVPGHALP
ASAAPQDMKQEKNTNGPAEIRKDDGKLLVPDLVSKPQPSPGGQSSCSSDRSPLGSTTNND
SGVEMTGNTGGSYEDLSTLEDVVPGDPMGTSGLMALQKLENLRIDKLKQMRKPSTKGLNL
PAIPGAGLPGDVPRVCVPPPAASQRRVVELSAAEVAVPPSERRSSATSTISSAYTVSRRS
SAASPYLPGPNLPGEGGTMPARSDGYDCISPDELRRSGNADPCGALPGVGSLTAAQHYRL
KAKYAAATGGPPPTPLPGVEPPNVGGHGGLPGECLEPAVPSFFANGLLRRHSSNDRYVSS
LHPHLAPGNDVRRASDPARIAANPHSVPKVQRFKSVGNVNAPGGGRAALQPLGASDGNLQ
RRVFSPHPPSISENVYLESVNPDGPGPGAGSGLLEMDPFLNYPEESFPCQGANVQLQCGG
LYGTAQRTPGGGMQLNPGGHREMEEGLLQPEFSLPQCQMNQHFHGLRGGSGTVLPQWEEP
PQSDHLEMGSGQPAVSAVPETHRHRHSALYPPPNHCVQHPKPMSTGHDGGFSDGRRLNCL
QIKSEQRYSAPAPALTPCHDAKATRPPAFGRAVSGYQAEEQPAGGYAGVLSPRGRRAHTP
TSQAKEVMVRSYVQAQQALMWGEPPKGGEAGVGLGGESGQYQGTHAAPYLGPKYSGYQPK
ANHLQGLLENPHLLSPPCFNPEMVPHPPSGAKPPGHQNSVGYGGDLADPIPSYEAAGANP
QRGLRLPPVHPAPEVPGDTLLCYPGQVGKGSHKLQGPPAASCGGPGHCTGSLGGSKGSSC
FYPDSGQQAFNSLDSLDLENTHLDFAAIVEDAESPTLLPGPPSPTGGLLLPAPGGANMAV
GDMSSMLSTLAGESHFLNSLS
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaccccgtcacgcctcaggcccccggctacgccgagcactgctgcccgcggccg
ctgcatggagcctctgcgggcacaccggggctgcaaggactcgatttcccagtgtgccat
cagcccaacctggccagcagccaccatggctatgggctggtgcccggcactgagcatccg
ggtggtgctgctgatggctcgcggttctcgacgccccgtggtgccggcaagctgggcaag
aagcgggcactgtccatctcacccctgtcagactctagcgttgacctgcagacggtgatc
cgcacctcgcccaactccctcgttgccttcatcaactcccgttgcgcttccgccggtggc
tcctatggtcacctctccatcagcaccatcagtccatcgttggggtaccagaaccctccg
gggcagcagaagggccaagggcaactgtttagccacactccacccctgccaccgtgtagc
tcccacgaaaccctgtcctcccgcccagggctcctgcatcccaccccggctcgtgggacc
atcaaacactgccagcagctaaagttggagaggagcctgagtagccctctgacagccaaa
tacccagaggagaaatcggagggtgacatttccagtccggcctccaccggcacacaggac
cccttgctggggatgctcagcgttcgggatgatctggagaaggaggatgggaaacctgaa
tcggagaccatctatgaaacaaactgctactgggatggctgcgccaaggagtttgacacg
caggagcagctggtgcatcacatcaacaacgagcacatccacggggagaagaaggagttt
gtgtgccactgggcagcgtgctcccgcgagcagcggcccttcaaggctcagtacatgctg
gtggtgcacatgaggcgccacacgggcgagaagcctcacaagtgcacgtttgagggctgt
aacaaagcgtactcccgcctggagaacctcaagacccatctgcgctcccacacgggtgag
aaaccctatgtgtgtgagcacgagggttgtaacaaagccttctccaacgcttccgaccgg
gccaagcatcagaaccgcacccactccaatgagaagccatacatctgtaagatcccgggc
tgcaccaagcgctacacggatcccagctccctgcgcaaacacgtgaagacggtgcacggc
cccgacgcccacgtcaccaagaagcaccggggcagcgttgtgcctggccatgcactgcct
gcctctgctgcaccccaggacatgaagcaggagaaaaacaccaacggccctgctgagatc
cgcaaggatgacggcaagctgctggtgcctgacttggtgtcgaagccacagcccagccct
ggtgggcagtcatcgtgcagcagtgaccgctcccccctcggcagcaccaccaacaacgac
agcggtgtggagatgacgggcaacacgggtggcagctacgaggatctgtccacgctggag
gatgtggtgcccggggatcccatgggcacctcggggctgatggccctccagaagctcgag
aaccttcgcattgacaaactgaagcagatgaggaagccatcaaccaagggcctgaacctg
ccagccatccccggagccggtctgcccggagatgtgcccagggtctgcgtgccgccgccg
gctgcgtcccagcgccgcgtcgtggagctgtcggctgcagaggtggccgttccgccgagc
gagcgccgcagcagcgccaccagcaccatcagctcagcctacaccgtcagccgccgctcc
tccgccgcctccccgtacctaccggggccgaacctgcccggcgagggggggacgatgccg
gcacgctcggatggctacgactgcatctctccggatgagctgcggcgctccggcaacgcc
gatccctgcggggcgctgccgggcgtggggagcctcacggcggctcagcattaccgtctc
aaagccaaatacgccgcggccacgggggggccgcccccaactccgctgcccggcgtggag
ccgccgaacgtgggcggccacggcggtttgcccggggagtgcctcgagccggccgtgccc
tccttcttcgcgaacggtttgctgcgaaggcacagctccaacgaccgctacgtgagcagc
cttcaccctcacctggcgcctggcaacgacgtgaggagggccagcgacccggcccggatt
gcagccaaccctcactctgtgcccaaagtgcagcgttttaaaagcgtggggaacgtgaat
gcgccgggaggcggcagagctgccctgcagcccctgggtgcttccgacggcaacctgcag
cgccgcgtcttctcccctcacccacccagcatcagtgagaatgtttacctggagagcgtg
aacccggacggccccgggcctggcgcggggtctggcttgctggaaatggacccgttcttg
aactaccccgaggaaagcttcccgtgccagggggcaaacgtgcagctgcagtgcgggggt
ctgtatggcaccgctcagcggaccccggggggcggaatgcagctgaacccgggtgggcac
agggagatggaggagggattgctgcagcctgagttctccctcccgcagtgccagatgaac
cagcacttccacggcctgcgtggcggcagcgggaccgtgctgcctcaatgggaggagccc
ccccaaagcgatcacctggagatgggctccgggcagccagcagtgagcgccgtgcctgag
acgcaccgccaccgtcacagcgctctgtacccaccgcccaaccactgcgtgcagcacccc
aaaccgatgagcacgggccacgatggtggcttttcagatggccgtcgcttgaactgcctg
cagatcaaatctgagcagcggtactcggctcctgccccggccctcaccccgtgccacgat
gccaaagccacgcggccgcccgcgttcggccgggctgtgagtgggtaccaggctgaggag
cagccagccggcggctacgcgggcgtgctgagcccacgggggaggagagcccacaccccc
acttcgcaggccaaagaggtgatggtccgcagctacgtgcaggcgcagcaggccctgatg
tggggagagccccccaagggcggtgaggccggcgtggggctgggcggtgagtctgggcag
taccagggcacgcacgcagcgccgtaccttggccccaagtactctggttaccagcccaaa
gccaaccacctgcaggggctgctggagaacccccacctcctgagccccccgtgctttaac
cctgagatggtgccacatccccccagcggtgccaagccaccgggccaccagaacagcgtg
ggctatgggggcgacctggcagatcccatcccctcctacgaggcagcgggtgccaacccc
cagcgcgggctgcgcctgcccccggtccaccctgcccccgaagtgcccggtgatacactg
ctctgctacccgggccaggtgggcaaaggcagccacaagcttcagggtccgcctgccgca
agctgtgggggtcccgggcactgcactgggagcctggggggcagcaaaggcagctcttgt
ttctacccagactcggggcagcaggcattcaacagcctggactcgctggacctggagaac
actcacctggactttgctgccatcgtggaggatgcagagagccccacgctcctgcctggc
ccccccagccccactgggggtctcctgctgccagcgcccggcggtgccaacatggccgtg
ggtgacatgagctccatgctgagcactttggctggggagagccacttcctcaactccctc
tcctga

DBGET integrated database retrieval system