KEGG   Gallus gallus (chicken): 396075Help
Entry
396075            CDS       T01006                                 

Gene name
S100A11
Definition
(RefSeq) protein S100-A11
  KO
K23765   
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_4
Motif
Other DBs
NCBI-GeneID: 396075
NCBI-ProteinID: NP_990497
CGNC: 6970
Ensembl: ENSGALG00000036711
UniProt: P24479
Position
25
AA seq 101 aa AA seqDB search
MSKVSPTETERCIESLLAVFQRYAGREGDNLKLSKKEFRTFMNTELASFTKNQKDPAVVD
RMMKRLDINSDGQLDFQEFLNLIGGIAVACHDALLVQPPHP
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtttcccccactgagaccgagcgctgcattgagtcgctgctggccgtcttc
cagaggtacgcagggcgtgaaggagacaacctcaagctctccaagaaagaattccggact
ttcatgaacaccgagctggcttccttcacaaagaatcagaaggaccccgctgttgtggac
aggatgatgaagcggcttgatatcaacagcgatgggcagctggacttccaggagttcctg
aatctcataggaggcattgcagtggcctgccatgatgcactgctcgttcagcctcctcat
ccttag

DBGET integrated database retrieval system