KEGG   Gallus gallus (chicken): 396095Help
Entry
396095            CDS       T01006                                 

Gene name
STMN2
Definition
(RefSeq) stathmin-2
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: Stathmin Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 396095
NCBI-ProteinID: NP_990512
CGNC: 49645
Ensembl: ENSGALG00000039690
UniProt: Q90987
Position
2
AA seq 179 aa AA seqDB search
MAKTAMAYKEKMKELSMLSLICSCFYPEPRNMNIYKYDDMEVKQINKRASGQAFELILKP
PSPVSEAPRTLASPKKKELSLEEIQKKLEAAEERRKSQEAQVLKHLAEKREHEREVLQKA
LEENNNFSKMAEEKLILKMEQIKENREANLAALIERLQEKERHAAEVRRNKELQVELSG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaacagcaatggcttacaaggaaaagatgaaggagctgtccatgctctccctg
atctgctcctgtttttatcctgaacctcgcaacatgaacatctataaatatgatgacatg
gaagttaaacaaatcaacaaacgtgcctcaggccaggcctttgaactgatcctaaagcca
ccatccccagtctcggaagcaccacgaactttagcctctccaaagaagaaagagctctcc
cttgaggagatccagaaaaagctggaggctgccgaggagaggagaaagtcccaggaggcc
caggtgctgaaacatctggcggagaagagggaacatgagcgagaggtgcttcagaaagct
ctggaggagaacaataacttcagcaaaatggcagaggaaaagctgatactgaaaatggaa
cagatcaaagaaaaccgtgaagctaatctagctgctcttattgaacgtctccaagaaaag
gagaggcatgctgcagaggtccgtagaaacaaggagctccaggtggaactgtctggctga

DBGET integrated database retrieval system