KEGG   Gallus gallus (chicken): 396100Help
Entry
396100            CDS       T01006                                 

Gene name
EFNA5
Definition
(RefSeq) ephrin-A5 precursor
  KO
K05462  ephrin-A
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396100 (EFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    396100 (EFNA5)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    396100 (EFNA5)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   396100 (EFNA5)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   396100 (EFNA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 396100
NCBI-ProteinID: NP_990515
CGNC: 49648
Ensembl: ENSGALG00000000280
UniProt: P52804
Position
Z
AA seq 228 aa AA seqDB search
MPHVEMLLLAVAALWVCVRGQEPGRKAVADRYAVYWNSTNPRFQQGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSSCDHISKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPANSCMKTIGVHDRVFDVNDK
VENSLEPADDTVRESAEPSRGENAAQTPRIPIRLLATLLFLLAMLLIL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacgtggagatgctgctgctggcggtcgcggcgctgtgggtgtgcgtgcgcggg
caggagcccggccgcaaggcggtggccgaccgctacgccgtctactggaacagcaccaac
cccagattccagcagggagactaccacatcgatgtgtgcatcaacgactacctggatgta
ttctgccctcactatgaagactcggtgccagaagataagaccgaacgctatgttctgtac
atggtgaactttgatggctacagctcctgcgatcacatttccaaagggttcaagaggtgg
gagtgcaatcggccacactccccgaatggaccgctgaagttctcagaaaaattccagctc
ttcacacccttctcactaggatttgagttcaggccaggccgggagtatttctacatctct
tctgcgatcccagataatggaaggagatcctgtctaaagcttaaggtctttgtgcgacca
gcaaacagctgtatgaaaactataggtgttcatgatcgtgttttcgatgttaacgacaaa
gtagaaaattcattagaaccagcagatgataccgtgcgtgagtcagccgagccatcccgt
ggtgagaacgcggcacagacaccgaggatacccatccggcttttggcaactctattgttc
ctcctggcaatgcttttgatattatag

DBGET integrated database retrieval system