KEGG   Gallus gallus (chicken): 396110
Entry
396110            CDS       T01006                                 

Gene name
FOXG1
Definition
(RefSeq) forkhead box protein G1
  KO
K09385  forkhead box protein G
Organism
gga  Gallus gallus (chicken)
Pathway
gga04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    396110 (FOXG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396110 (FOXG1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    396110 (FOXG1)
SSDB
Motif
Pfam: Forkhead SelP_N
Other DBs
NCBI-GeneID: 396110
NCBI-ProteinID: NP_990524
CGNC: 49654
Ensembl: ENSGALG00000036364
UniProt: Q90964
Position
5
AA seq 451 aa
MLDMGDRKEVKMLPKSSFSINSLVPEAVQSDNHSGHSHHNSHHPHHHHHHHHHHPPPPQQ
PQRAAAAEEEDEEKAPLLLPPPAAGALEAAKAEALAGKGEAGAAAAELEEKEKAAEEKKG
AAEGGKDGESGKEGEKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYY
RENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRST
TSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTASAYPSHP
MPYSSVLTQNSLGNNHSFSTSNGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSG
TYSLNPCSVNLLAGQTSYFFPHVPHPSMTSQSSTSMTARAASSSTSPQAPSTLPCESLRP
SLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgttggacatgggagataggaaggaagtgaaaatgctgcccaagtcctccttcagcatc
aacagcctggtgcccgaagccgtgcagagcgacaaccacagcggccacagccaccacaac
agccaccatccgcaccaccaccaccaccaccaccaccaccacccgccgccgccgcaacag
ccccagcgcgccgccgcggccgaagaagaggacgaggagaaggcgccgttgctgctgccg
ccgcccgccgccggcgccctggaggcggctaaggccgaggcgctggcggggaagggcgag
gcgggcgcggcggcggcggagctggaggagaaggagaaggcggccgaggagaagaagggg
gcggccgaggggggcaaggacggggagagcggcaaggagggcgagaagaagaacggcaag
tacgagaagccgccgttcagctacaacgcgctcatcatgatggccatccggcagagcccc
gagaagcgcctgacgctcaacggcatctacgagttcatcatgaagaacttcccatactac
cgggagaacaagcagggctggcagaactccatccgccacaacctctctctcaataagtgc
ttcgtcaaggtgccccgccactacgacgacccgggcaaagggaactactggatgctggac
ccgtccagcgacgacgtcttcatcgggggcaccacgggcaaactgcgccggcgctccacc
acttcgcgggccaagctggccttcaagcgcggcgcccgcctcacctccaccggcctcacc
ttcatggaccgggcggggtccctctactggcccatgtccccctttctgtccctgcaccac
ccgcgggccagcagcacgctgagctacaacgggacggcgtccgcctaccccagccacccc
atgccctacagctcggtgttgactcagaactccttggggaacaatcactccttttccacg
tccaacgggttgagcgtcgatagactcgtcaacggggagatcccctacgccactcaccac
ctcacggccgccgccctggccgcctcggtgccgtgcggcttgtcggtcccctgctccggc
acctactccctaaacccctgctccgtgaacctcctggcgggacagacgagttactttttc
ccccacgtccctcacccctcaatgacttctcagagcagcacttcgatgacggccagggcc
gcctcttcgtccacatcgccgcaggcaccctccaccctgccctgcgagtccctaagaccc
tctttgccgagtttcacgacgggactctccggaggactctccgattatttcacacatcaa
aatcaggggtcttcttccaaccctttaatacattaa

DBGET integrated database retrieval system