KEGG   Gallus gallus (chicken): 396117
Entry
396117            CDS       T01006                                 

Gene name
GNOT2
Definition
(RefSeq) Gnot2 homeodomain protein
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 396117
NCBI-ProteinID: NP_990529
CGNC: 49659
UniProt: Q98911
Position
4
AA seq 168 aa
MPPPVPSVPSPCRPAGFTIAALLGRSSPPPAPPPPPTPPLPPLPHWGAPPGPLCAACCGP
PPAWAARLGATGFLLSKCCFPIFKTKAGKAKRVRTIFTSDQLARLEKEFARQQYMVGTER
CLLASALHLTEEQVKVWFQNRRIKWRKQSLEQQQAKLPRWAGHPTEEP
NT seq 507 nt   +upstreamnt  +downstreamnt
atgccgcccccggttccttccgtcccctcgccctgccggccggcaggcttcaccatcgca
gcgctgctgggacgctcctcgccccccccggcaccgccgccaccaccgacccctccgctg
ccgccgctgccgcactggggggcacctcccgggccgctctgcgctgcgtgctgcggaccc
ccgcccgcctgggctgctcgcctcggagccacagggttcctgctctccaagtgctgcttc
cccatcttcaaaaccaaggctggcaaagccaagcgggtgcgcaccatcttcaccagcgac
caactggcacggctggagaaggagtttgcccggcagcagtacatggtgggcacggagagg
tgcctgcttgcctctgcactgcacctcaccgaggagcaggtgaaagtctggttccaaaac
cgaaggatcaaatggaggaagcaaagcctggagcagcagcaagccaaactgccaagatgg
gctggccaccccacagaggagccctga

DBGET integrated database retrieval system