KEGG   Gallus gallus (chicken): 396128
Entry
396128            CDS       T01006                                 

Gene name
CSRP2
Definition
(RefSeq) cysteine and glycine-rich protein 2
  KO
K09377  cysteine and glycine-rich protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396128 (CSRP2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region, LIM-only transcription (co-)factors
    396128 (CSRP2)
SSDB
Motif
Pfam: LIM DUF4428
Other DBs
NCBI-GeneID: 396128
NCBI-ProteinID: NP_990539
CGNC: 66221
Ensembl: ENSGALG00000029921
UniProt: P50460 C4P6P8
Position
1
AA seq 194 aa
MPNWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDAEVYCKS
CYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESTPSPHRPTTNPNTSKFAQKFGGAEKC
SRCGDSVYAAEKVIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKG
FGYGQGAGALVHAQ
NT seq 585 nt   +upstreamnt  +downstreamnt
atgccgaactggggaggtggcaacaaatgtggtgcctgcggccggacggtctaccatgct
gaggaggtgcagtgcgacggacggagcttccatcgctgctgcttcctctgcatggtttgc
aggaagaatttggacagcacaactgttgcgattcacgatgctgaagtttactgcaaatct
tgctatggaaagaagtacggcccaaaaggttacggctatgggcaaggggcgggcacgctg
aacatggacaggggagagagactaggcatcaagcctgagagcacaccctctcctcaccga
cccaccacaaacccaaatacttcaaaattcgctcagaagtttggaggtgcagagaaatgt
tctcggtgtggggattctgtttatgcggcggagaaagtcataggtgctggaaagccatgg
cacaagaactgcttccgatgtgccaagtgtgggaaaagtctagaatctacaaccctaact
gaaaaagagggagaaatctactgtaaaggctgttacgcaaagaacttcggccctaaagga
tttggctatggtcagggagcaggagccctcgttcatgcccagtga

DBGET integrated database retrieval system