KEGG   Gallus gallus (chicken): 396140
Entry
396140            CDS       T01006                                 

Gene name
ST3GAL1
Definition
(RefSeq) CMP-N-acetylneuraminate-beta-galactosamide- alpha-2,3-sialyltransferase 1
  KO
K00780  beta-galactoside alpha-2,3-sialyltransferase (sialyltransferase 4A) [EC:2.4.99.4]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00512  Mucin type O-glycan biosynthesis
gga00533  Glycosaminoglycan biosynthesis - keratan sulfate
gga00603  Glycosphingolipid biosynthesis - globo and isoglobo series
gga00604  Glycosphingolipid biosynthesis - ganglio series
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    396140 (ST3GAL1)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    396140 (ST3GAL1)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    396140 (ST3GAL1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    396140 (ST3GAL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    396140 (ST3GAL1)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.4  beta-galactoside alpha-2,3-sialyltransferase
     396140 (ST3GAL1)
Glycosyltransferases [BR:gga01003]
 Terminal extension
  Sialyltransferase
   396140 (ST3GAL1)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 396140
NCBI-ProteinID: NP_990548
CGNC: 12118
Ensembl: ENSGALG00000037773
UniProt: Q11200
Position
2
AA seq 342 aa
MVTVRKRNVKVFTFAFVLITVTSFLLNYKHQVTMTTWDPKHIISQFSEQVRKLIKFPRRP
CSCSTCISELGHSLWFDQRFNSTMQPFLTSQNALIPEDSYRWWLKLQGEKSPKNINDTLK
ELFGIIPGDRDPLQERGTFSCRRCAVVGNSGNLRQSQYGQDIDSHDFVLRMNRAPTIGYE
SDVGSKTTHHFVYPESYKELAENVSMIVIPFKTLDLRWIVTALTTGTINFTYVPVPRKIK
VRKEKVLIYNPSFIKYVYENWLQNHGRYPSTGLLSVIFALHVCDEVNVYGFGADSKGHWH
HYWENNASAGAFRQTGVHDGDFEFNVTLTLASIEKIKFFKGR
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggtcaccgtcaggaaaaggaacgtgaaggtcttcacattcgccttcgtactcatcacg
gtgacgtcattcctgctgaactacaagcaccaggtgaccatgaccacttgggatcctaaa
catatcatcagtcagttttctgagcaagtccgaaaactcatcaaatttcctaggaggccg
tgcagctgtagcacctgtatttccgagctgggacattccctctggttcgaccagaggttt
aactcaactatgcaacctttcctgacctcacaaaatgccttgatcccagaggacagctac
aggtggtggctgaaactgcaaggagagaaatctccaaagaatattaatgatactctcaag
gaattgtttgggatcattcctggggacagggacccactgcaggagcgaggcactttctca
tgcagacggtgtgccgtcgttggcaactccggcaaccttcgtcagtctcaatatggccaa
gatattgactcccatgactttgtgctcagaatgaaccgtgcacccaccattggctacgaa
tcagatgttgggagcaagactacccaccactttgtttatccagagagctacaaagagctg
gcagaaaatgtgagcatgatcgtgatccccttcaaaaccctggacctgcgctggattgtt
accgctctcaccacaggcactatcaacttcacatatgttcctgttccacggaaaatcaaa
gtcagaaaagaaaaggtcctgatttacaatccatcctttatcaaatacgtctatgaaaac
tggcttcagaatcatggaagatacccttccacaggccttctttctgtgatatttgcactc
catgtatgcgatgaggtgaatgtgtatggttttggagcagacagcaaaggacactggcat
cactactgggaaaataatgcttcagctggggctttccgacagacaggtgtccatgatgga
gattttgagttcaatgtaactttgactcttgcctccattgaaaaaataaaatttttcaag
ggcagatga

DBGET integrated database retrieval system