KEGG   Gallus gallus (chicken): 396142
Entry
396142            CDS       T01006                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04110  Cell cycle
gga04137  Mitophagy - animal
gga04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    396142 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    396142 (E2F1)
   04218 Cellular senescence
    396142 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396142 (E2F1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    396142 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP B-block_TFIIIC
Other DBs
NCBI-GeneID: 396142
NCBI-ProteinID: NP_990550
CGNC: 2206
Ensembl: ENSGALG00000003045
UniProt: Q90977
Position
20
AA seq 403 aa
MATAGGAAGLAALLGGASPHLLIVSASEEPAGGCRPDADLLLFATPQPSRPGPAPRRPAL
GRPPVKRKLNLETDHQYIAESLPAARGRARIPGRGAKSPGEKSRYETSLNLTTKRFLELL
SQSPDGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLITKKSKNNIQWLGSQVAAGASSRQ
RLLEKELRDLQAAERQLDDLIQTCTVRLRLLTEDPSNQHAAYVTCQDLRSIVDPSEQMVM
VIKAPPETQLQVSDPGEAFQVSVRSTQGPIDVFLCPEDSSGVCSPVKSPFKAPAEELSPG
SSQQRASPLLHSAQDVNMLLPEALLPGTALPTKCPTEDVSLSPLASMDTLLEHGKDDFPG
FLADEFIALSPPQPQDYHFGLEEGEGISELFDCDFGDFTHLDF
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggctacggcgggcggcgcggcggggctggcggcgctgctgggcggcgcctccccgcac
ctcctcatcgtctcggcctccgaggagcccgcgggcggctgccgccccgacgccgacctc
ctgctcttcgccacgccgcagccctcccgccccggccccgcgccgcgccgccccgcgctg
ggccgcccgccggtgaagcggaagctgaacttggagacggatcaccagtacatagccgag
agcctgcccgcggcccgcggcagggcccggatccccggcagaggggcaaagtctcctggg
gagaagtcccgctatgaaacctcgctgaacctcaccaccaagcgcttcctggagctgctc
agccaatcccccgacggtgtggtggacctcaactgggcagccgaggtgctgaaggtgcag
aagaggcgcatctacgacatcaccaatgtcctggagggcatccagctcatcaccaagaag
tccaagaacaacatccagtggctgggcagccaggtggccgcgggggcctccagccgacag
cggctgctggagaaggagctgcgggatctgcaggcggccgagcggcagctggacgatctc
atccagacgtgcacggtcaggctgcggctgctcactgaggatccctccaaccagcacgca
gcctacgtcacctgccaggacctccggagcatcgtggacccctctgagcaaatggtgatg
gttatcaaggcacccccagagacccagctgcaagtctcggacccgggagaggctttccag
gtctccgtgagaagcactcagggccccatcgacgtgttcctctgtcccgaggacagctca
ggggtctgcagccccgtcaagagccccttcaaggcacctgctgaggagctctcccccggc
tcatcgcagcagagagcctccccgctcctgcattctgcccaggatgtgaacatgctgctg
cctgaggcactgctcccaggcacagcgctgccgaccaagtgccccacagaggacgtgagc
ctgtcgccgctagcctccatggacacactcctggagcatggcaaggacgatttcccgggc
ttcctggcggatgagttcattgcactgtcaccaccacagccacaggattaccacttcggc
ctggaggagggtgagggcatcagtgagctctttgactgtgactttggggacttcacgcac
ttggacttctga

DBGET integrated database retrieval system