KEGG   Gallus gallus (chicken): 396143
Entry
396143            CDS       T01006                                 

Gene name
CNGA1
Definition
(RefSeq) cyclic nucleotide-gated channel rod photoreceptor subunit alpha
  KO
K04948  cyclic nucleotide gated channel alpha 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    396143 (CNGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    396143 (CNGA1)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   396143 (CNGA1)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding CDC45 Connexin Ion_trans_2 Presenilin SlyX Tim54 Eapp_C Menin CPSF100_C NPR3 Zip Sec62 SpoIIP RNA_pol_Rpc4
Other DBs
NCBI-GeneID: 396143
NCBI-ProteinID: NP_990551
CGNC: 10542
Ensembl: ENSGALG00000014136
UniProt: Q90980
Position
4
AA seq 645 aa
MKVGVIETHHSHPIIPSVVVQDTSEDPGLIEKGENRFARQWYLPGAFAQYNINNNSNKDE
EKKKKKEKKSKSENKKDGERQKNKEKKEKHKNKDKKKGKEEEKKKDIFIIDPAGNMYYNW
LFCITMPVMYNWTMIIARACFDELQNDYLAVWFIVDYVSDVIYIADMFVRTRTGYLEQGL
LVKEEQKLKEKYKSSLQFKLDFLSIIPTDLLYFKLGLNYPELRINRLLRVARMFEFFQRT
ETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGADTWVYPNTSHPEFARLTRK
YVYSLYWSTLTLTTIGETPPPVRDSEYFFVVVDFLVGVLIFATIVGNVGSMISNMNAARA
EFQAKIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAIN
VHLETLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICRKGDIGREMYIIKEGKLAVVA
DDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEY
PDAKAMLEEKGKQILMKDGLLDIEVANLGSDPKDLEEKVAYMEGSMDRLQTKFARLLAEY
DAAQQKLKKRLTQIEKILKPVMEQEFLDFEEADPPTDKPGVTKTE
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgaaggtaggagtaattgagacccatcactcccatccaattattcccagcgtggtggtg
caagacaccagtgaggatcctggactgatagagaaaggggaaaacagatttgccaggcaa
tggtatctacctggtgcatttgcacagtacaatattaacaacaacagtaataaagatgaa
gagaaaaagaagaaaaaagaaaagaagagcaagtcagaaaataaaaaggatggagaaaga
caaaagaacaaggaaaaaaaggaaaaacacaaaaataaagacaagaagaaaggaaaggag
gaagagaagaagaaagatattttcatcattgatccagcaggaaatatgtattacaactgg
ttgttctgcatcacaatgcctgtcatgtacaactggactatgattattgctagagcctgt
tttgatgagcttcagaatgactacttagctgtatggtttattgttgattatgtttctgat
gtcatctatattgctgacatgtttgtacggacaagaacaggttacctggaacaaggtctt
ctagtgaaagaagaacaaaagcttaaagagaaatacaagagctccctacaattcaaatta
gattttctgtcaatcataccaactgacctcttatactttaagttaggactgaattacccg
gaattgagaataaaccgactgctccgagtagctcggatgtttgaatttttccagcgaaca
gaaacaagaacaaactacccaaatatcttcaggatctctaaccttgtcatgtacattgtg
attattattcactggaatgcctgtgtgtattactcaatctcaaaagcgattggatttggg
gctgacacgtgggtgtaccccaacacctcccatcctgagtttgcccgtctgaccagaaag
tacgtctatagcctctactggtccactctgaccctgactactattggtgaaacacctcct
cctgtacgagattctgagtatttctttgtggttgttgacttcttggttggagtgttgatt
tttgctaccatcgttggtaacgtcggctctatgatctccaacatgaatgctgccagggca
gagtttcaagccaagattgatgctatcaagcagtacatgcactttcggaatgtaagtaaa
gacatggaaaaaagagttataaagtggtttgactatctctggacaaacaaaaaggctgtg
gatgaaagggaagtcttgaagtatctgccagacaaactaagagcagagattgcaatcaac
gttcacctggaaacattaaaaaaagttcggatttttgcagactgtgaagctggtctgttg
gttgaacttgttttgaaactccagccacaagtgtacagtcctggagactatatttgcaga
aaaggagatattggacgagaaatgtacattatcaaagaaggcaaactcgcagtagtcgct
gatgatggagtgacacaatttgtggtcctaagtgatggcagctattttggagaaatcagc
attcttaatatcaaaggtagcaaagctggcaatcgaagaacggccaatattagaagtatt
ggatactcagacctgttctgtctgtctaaagatgatctcatggaggctttaacagagtat
cctgatgcaaaggcaatgctggaagagaaaggtaaacaaatcctcatgaaagatggattg
ctggatattgaagttgcaaatttaggaagtgatcctaaagacctggaagagaaggttgct
tatatggaaggatcaatggacaggttacaaacgaagtttgccaggttgttagctgagtat
gatgctgcacaacagaaactgaaaaaaagacttacacagattgagaaaatattgaagcca
gttatggagcaagaattcttagactttgaagaagcagatccacccacagataaacctgga
gtgacaaaaacagaataa

DBGET integrated database retrieval system