KEGG   Gallus gallus (chicken): 396145
Entry
396145            CDS       T01006                                 

Gene name
INS-IGF2
Definition
(RefSeq) insulin preproinsulin precursor
  KO
K04526  insulin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04068  FoxO signaling pathway
gga04114  Oocyte meiosis
gga04140  Autophagy - animal
gga04150  mTOR signaling pathway
gga04810  Regulation of actin cytoskeleton
gga04910  Insulin signaling pathway
gga04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396145 (INS-IGF2)
   04068 FoxO signaling pathway
    396145 (INS-IGF2)
   04150 mTOR signaling pathway
    396145 (INS-IGF2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    396145 (INS-IGF2)
  09143 Cell growth and death
   04114 Oocyte meiosis
    396145 (INS-IGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396145 (INS-IGF2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    396145 (INS-IGF2)
   04914 Progesterone-mediated oocyte maturation
    396145 (INS-IGF2)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 396145
NCBI-ProteinID: NP_990553
CGNC: 4941
Ensembl: ENSGALG00000006552
UniProt: P67970
Position
5
AA seq 107 aa
MALWIRSLPLLALLVFSGPGTSYAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQ
PLVSSPLRGEAGVLPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN
NT seq 324 nt   +upstreamnt  +downstreamnt
atggctctctggatccgatcactgcctcttctggctctccttgtcttttctggccctgga
accagctatgcagctgccaaccagcacctctgtggctcccacttggtggaggctctctac
ctggtgtgtggagagcgtggcttcttctactcccccaaagcccgacgggatgtcgagcag
cccctagtgagcagtcccttgcgtggcgaggcaggagtgctgcctttccagcaggaggaa
tacgagaaagtcaagcgagggattgttgagcaatgctgccataacacgtgttccctctac
caactggagaactactgcaactag

DBGET integrated database retrieval system