KEGG   Gallus gallus (chicken): 396152
Entry
396152            CDS       T01006                                 

Gene name
RUNX1
Definition
(RefSeq) runt-related transcription factor 1
  KO
K08367  runt-related transcription factor 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    396152 (RUNX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396152 (RUNX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    396152 (RUNX1)
SSDB
Motif
Pfam: Runt RunxI
Other DBs
NCBI-GeneID: 396152
NCBI-ProteinID: NP_990558
CGNC: 49673
Ensembl: ENSGALG00000016022
UniProt: Q90813
Position
1
AA seq 408 aa
MASNSVFDSLPSYQHFLRDTSTSRRFTPPSTALSPGKMSEPLPLPGAEHSGALAGKLRAA
DRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMA
GNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIK
ITVDGPREPRNTRQVQPSPPWSYDQSYQYLGSIATPSVHPATPISPGRASGMTSLTAELS
SRLSGASDLTAFSDPRVGIDRSFSALPSISDPRMHYPGAFTYTPTPVSSGIGIGMSAMST
ATRYHTYLPPPYPGSSQAQGSPFQTSSPSYHLYYGTSAGSYQFSMISGGDRSPPRIHPPC
TNASTGSTLLNPNLPNQSDVVEAEGSHSNSPTNMGTTARLEEAVWRPY
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcttcaaacagcgtatttgattcacttccttcttaccagcacttcttgagagatacc
agcaccagccgccgcttcacgccgccctccaccgcgctgagcccggggaagatgagcgag
ccgctgccgctgcccggcgccgagcacagcggagcgctggcggggaagctgcgcgccgcc
gaccgcagcatggtggaggtcctggcggaccaccccggggagctggtgcgcaccgacagc
cccaacttcctctgctccgtgctgcccacccactggcgctgcaacaagacgctgcccatc
gccttcaaggtggtggccttgggagacgtacccgatgggacgctggtcacggtgatggct
ggaaacgatgagaactactctgcagagctcagaaatgcgacggctgccatgaaaaaccaa
gtggcgaggttcaacgacctcagatttgtgggtagaagtggaagagggaaaagcttcaca
ctgactatcacagttttcacaaacccgccacaagtagccacgtaccacagagccatcaag
ataacggtggatggaccacgcgaacccagaaacacgaggcaagtgcagccgtccccgcca
tggtcctacgaccagtcctaccagtacctgggctccatcgcgactccctcggtgcaccct
gccacgccgatatcgcctggcagggccagcggcatgacatccctcaccgcagagctttcc
agccgcctctcaggtgcttctgacttgacggcattcagtgaccccagagtggggatcgac
cgctccttctccgcgctcccttccatttctgatcctcggatgcactacccgggagcgttc
acctacacgccaacacccgtcagttcggggatagggatcggtatgtctgctatgtccacg
gccaccagataccacacttacctcccacctccatatcccggttcctctcaggcccaaggc
agcccattccagaccagctcaccttcgtaccacctctactacggaacctccgccgggtcc
tatcagttctccatgatctcaggaggagaccggtcccccccgcgcatccaccccccttgc
accaatgcttccacaggatcgacactcctcaaccccaaccttcccaaccaaagcgatgtg
gttgaggcagaagggagccacagcaactccccaaccaacatgggtaccacggcaaggcta
gaggaagcggtttggaggccatactga

DBGET integrated database retrieval system