KEGG   Gallus gallus (chicken): 396160Help
Entry
396160            CDS       T01006                                 

Gene name
WNT1
Definition
(RefSeq) protein Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    396160 (WNT1)
   04150 mTOR signaling pathway
    396160 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    396160 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    396160 (WNT1)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Morphogens
   396160 (WNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 396160
NCBI-ProteinID: XP_015128668
CGNC: 49678
UniProt: Q91029
Position
33
AA seq 368 aa AA seqDB search
MRGPALLLALRALCALSALRGTARAVNNSGRWWGIINVASSTNLLTDSGSVQLVLEPGLQ
LLSRKQRRLIRQNPGILHSVSAGLQSAVRECQWQFRNRRWNCPTSQGPNIFGKIVNRGCR
ETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGR
EFVDSSEKGRDLRFLMNLHNNEAGRMTVFSEMRQECKCHGMSGSCTVRTCWMRLPTFRAV
GDVLKDRFDGASRVIYGNKGSNRASRVELHHLEPENPAHKPPSPHDLVYFEKSPNFCTYS
GKMGTAGTAGRACNSSSPGLDGCELLCCGRGFRTRTQRVTERCNCTFHWCCHVSCLNCTN
TQVLHECL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggccccgcgctgctcctcgcgctccgcgccctctgcgcgctctcggcgctccgc
ggcaccgcgcgggcggtgaacaacagcgggaggtggtggggcatcatcaacgtggcctca
tccaccaacctgctgacggattcgggcagcgtgcagttggttctggagcccggcctgcag
ctgctgagccgcaaacagaggcgtctgatccgacagaaccccggcatcctgcacagcgtc
agcgccgggctgcagagcgccgtccgggagtgccaatggcagttccgcaaccgccgctgg
aactgccccacgtctcagggccccaacatctttggcaagatcgttaacagggggtgccgg
gagacggcgttcatcttcgccatcaccagcgccggcgtgacgcactcggtggcccggtcc
tgctccgagggctccatcgaatcgtgcacctgcgattaccgccggcgcggcccggggggg
cccgattggcactgggggggctgcagtgataacatcgatttcgggaggctcttcgggagg
gaatttgtggattccagcgagaagggccgagatctgcgcttcctgatgaacctacacaac
aacgaggccgggcgcatgacggtcttctcggagatgcgccaggagtgcaaatgccacggc
atgtcgggctcctgcaccgtgcgcacctgctggatgcgcctgcccaccttccgcgccgtg
ggcgacgtcctcaaagaccgcttcgacggcgcctcgagggtcatctacggcaacaaaggc
agcaaccgagcctcgagggtcgagctgcaccacctggaacccgaaaacccggcccacaaa
cccccctcgccccacgatttggtttacttcgagaagtcgcccaatttctgcacctacagc
gggaagatggggacggcggggacggcggggcgggcgtgcaacagctcctccccggggttg
gatggctgtgagctgctgtgctgcgggagggggttccgtacgcgcacccaacgcgtcacc
gagcgctgcaactgcaccttccattggtgctgccacgtcagctgcctcaactgcaccaac
acgcaggtgctgcacgagtgtctgtga

DBGET integrated database retrieval system