KEGG   Gallus gallus (chicken): 396165Help
Entry
396165            CDS       T01006                                 

Gene name
BMP4
Definition
(RefSeq) bone morphogenetic protein 4 precursor
  KO
K04662  bone morphogenetic protein 4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    396165 (BMP4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    396165 (BMP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    396165 (BMP4)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    396165 (BMP4)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   396165 (BMP4)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Morphogens
   396165 (BMP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 396165
NCBI-ProteinID: NP_990568
CGNC: 49681
Ensembl: ENSGALG00000012429
UniProt: E1C0T2
Position
5
AA seq 404 aa AA seqDB search
MIPGNRMLMVILLCQVLLGGTNHASLIPETGRKKVAELQGQAGSGRRSAQSHELLRGFET
TLLQMFGLRRRPQPSKSAVIPSYMLDLYRLQSGEEEESLQEISLQYPERSTSRANTVRSF
HHEEHLESVPGPSEVPRIRFVFNLSSVPDNEVISSAELRLYREQVEEPSAAWERGFHRIN
IYEVMKPLSERSQAITRLLDTRLVHHNVTRWETFDVSPAVIRWTKDKQPNHGLVIEVTHL
HQAQTHQGKHVRISRSLPQGYGGDWAQLRPLLVTFGHDGRGHALTRRARRSPKHQRSRKN
KKNCRRHALYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSV
NSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcatcctactatgccaagtcctgctgggaggt
accaaccatgctagcctgatccccgagaccggcaggaagaaagtcgcagagcttcaggga
caagccggatccggacgccgctctgcccaaagccatgaactcttgcggggtttcgaaacg
actctgctgcagatgtttgggctgcgaaggcggccccagcccagcaaatcagccgtcatc
cccagttacatgctggatctctaccggctccagtccggagaagaggaggagagcctccag
gagatcagcctgcagtacccggagcgatcgaccagccgggccaacaccgtgaggagcttc
caccatgaagagcacctggagagcgtgccgggtcccagcgaagtgccgcggatccgcttc
gtcttcaacctcagcagcgtgccggacaacgaggtgatctcgtcggcggagctgcggctg
taccgggagcaggtggaggagccgagcgcggcgtgggagaggggcttccaccggataaac
atttacgaagtgatgaagccgctgtcggagcgctcgcaggccattacgcgcctgttggac
acgcggttggtgcaccacaacgtgacgcgctgggagacctttgatgtgagcccagccgtg
atccggtggaccaaggacaagcagcccaaccacgggctggtgatcgaggtgacccacctc
caccaggcacagactcatcagggcaaacacgtcaggattagccgatctttacctcagggg
tacggcggggactgggcgcagctcaggccgctcctggtcaccttcgggcacgacgggcga
ggccacgcgctgacccgcagggcccgccgcagccccaagcaccagcgttcccgcaagaac
aaaaaaaactgccgccgccacgctctctatgtggatttcagcgacgtgggttggaacgat
tggatcgtggcccccccgggctaccaggcgttttactgccacggggactgccccttccct
ctggccgaccacctcaactccaccaaccacgccatcgtgcagacgttggtcaactccgtc
aactccagcatccccaaggcctgctgcgtgcccacggagctgagcgccatctccatgctc
tacctggatgagtatgacaaggtggtgctgaaaaactaccaggagatggtggtggagggg
tgcgggtgccgctga

DBGET integrated database retrieval system