KEGG   Gallus gallus (chicken): 396178
Entry
396178            CDS       T01006                                 

Gene name
HOXD12
Definition
(RefSeq) homeobox protein Hox-D12
  KO
K09297  homeobox protein HoxC/D12
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396178 (HOXD12)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    396178 (HOXD12)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 396178
NCBI-ProteinID: NP_990580
CGNC: 7046
Ensembl: ENSGALG00000009274
UniProt: P24343
Position
7
AA seq 266 aa
MCDRSLYRSGYVGSLLNLQSPDSFYFPNLRANGSQLAALPTISYPRSSIPWTCPSPCAAQ
PQGHAFGGAAQPYLPGSVPISISSNSNKECLEENSKYYAHDASSKQEERCRQRQSFANDP
TITHAANLKPAKYDHSSLPRSLHGSAALFEVNSCTSSLKEDIKNSVNLNLTVQPAAVQSC
LRPSVQDGLPWCPTQGRSRKKRKPYTKQQIAELENEFLLNEFINRQKRKELSNRLNLSDQ
QVKIWFQNRRMKKKRVVMREQALSMY
NT seq 801 nt   +upstreamnt  +downstreamnt
atgtgtgatcgcagtctctacagatctggctacgttggttctctcttgaacttgcaatct
ccagattccttttattttcccaatttgcgggctaatggcagtcagttggcggctctgccc
accatttcctacccccggagctcgatcccgtggacgtgccccagtccgtgcgcagcccag
ccgcagggccacgcgttcggcggcgcggcgcagccgtacctccccggctccgttccaatc
agcatcagctccaacagcaacaaagagtgcctggaagaaaacagtaaatattacgcccac
gacgcgagctccaaacaagaggaaagatgcaggcagaggcaatctttcgcaaatgaccca
actattactcacgcagccaacttaaagcccgcaaagtatgaccactcgagcctgccgagg
agcttgcacggctcggccgctctttttgaagtgaattcctgcacttccagcctaaaggag
gacatcaagaattcggtcaacttgaacctgacagttcagcccgcggcagtccagtcatgc
ctcagaccttcagtgcaggatggtttgccttggtgccccacccaggggagatcgcgaaag
aaacggaaaccgtacacaaaacagcaaatcgccgaattggaaaacgagtttctcctcaat
gagtttattaaccgacagaagaggaaagaactatcaaacagactgaatttaagcgaccag
caagtgaaaatttggtttcagaaccgacgaatgaaaaagaaaagagtggtaatgcgcgag
caggcgctctctatgtactag

DBGET integrated database retrieval system