KEGG   Gallus gallus (chicken): 396182
Entry
396182            CDS       T01006                                 

Gene name
HHEX
Definition
(RefSeq) hematopoietically-expressed homeobox protein HHEX
  KO
K08024  homeobox protein HEX
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396182 (HHEX)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    396182 (HHEX)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 396182
NCBI-ProteinID: NP_990583
CGNC: 66222
Ensembl: ENSGALG00000030008
UniProt: Q05502
Position
6
AA seq 277 aa
MQYQAPGAAPAAALGVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAAPAPHSLPAPPPP
TLPSPNSSFTSLVAPYRTPVYEPTPIHPAFSHHLAATYGTGAYAGPLYSFPRAVGDYTHA
LIRQDPLGKPLLWSPFIQRPLHKRKGGQVRFSNEQTIELEKKFETQKYLSPPERKRLAKL
LQLSERQVKTWFQNRRAKWRRLKQENPQATKKEEAEGTGDHGDPRSEGSPSPAGGGEAEP
QDSPSAASQEDPESDVSDDSDQEVDIEGDKGFYSATR
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcagtatcaggcgccgggcgcggctccggcggcggccctgggcgtcggcgtccctctg
tacgcgcccacgccgctgctgcagcccgcgcaccccacgcccttctacatcgaggacatc
ctgggccgcggccccgccgccgcgccggccccccactccctgcccgccccgccgccgccg
acgctgccgtcgcccaactcctccttcaccagcctggtggccccgtaccggacccccgtc
tacgagccgacccccatccacccggccttctctcaccacctcgccgccacctacggcacc
ggcgcttacgccgggcccctctactcctttccccgcgccgtcggcgactacacgcacgca
ctgatccgccaggaccccctgggaaagccgctgctgtggagccccttcatccagcggccg
ctgcataagaggaagggtgggcaggtgcgcttctccaacgagcagaccatcgagctggag
aagaagttcgagacgcagaaatacctctccccgcccgagaggaagcgcctggccaagctg
ctgcagctcagcgagcgccaggtcaaaacgtggttccagaaccgcagagccaaatggagg
cgactgaagcaggagaacccccaggccaccaaaaaggaggaggcggaaggcaccggcgat
cacggcgaccctcggtcggagggcagccccagccccgcgggggggggcgaggccgagccg
caggacagcccttcggccgcctcgcaggaggaccccgagtccgacgtctccgacgactcc
gaccaggaggtggacatcgagggcgacaaaggcttctacagcgccacacgctga

DBGET integrated database retrieval system