KEGG   Gallus gallus (chicken): 396188Help
Entry
396188            CDS       T01006                                 

Gene name
HSP90AB1
Definition
(RefSeq) heat shock cognate protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
gga  Gallus gallus (chicken)
Pathway
gga04141  Protein processing in endoplasmic reticulum
gga04217  Necroptosis
gga04621  NOD-like receptor signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    396188 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    396188 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    396188 (HSP90AB1)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    396188 (HSP90AB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396188 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    396188 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gga03110]
    396188 (HSP90AB1)
   04131 Membrane trafficking [BR:gga04131]
    396188 (HSP90AB1)
   03051 Proteasome [BR:gga03051]
    396188 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:gga03029]
    396188 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396188 (HSP90AB1)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     396188 (HSP90AB1)
Chaperones and folding catalysts [BR:gga03110]
 Heat shock proteins
  HSP90
   396188 (HSP90AB1)
Membrane trafficking [BR:gga04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    396188 (HSP90AB1)
Proteasome [BR:gga03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    396188 (HSP90AB1)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    396188 (HSP90AB1)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   396188 (HSP90AB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 396188
NCBI-ProteinID: NP_996842
CGNC: 49691
Ensembl: ENSGALG00000010175
UniProt: Q04619
Position
3
AA seq 725 aa AA seqDB search
MPEQVQHGEDEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDTGKDLKIDIVPNPRDPTLTLLDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRTDHGEPIGRGTK
VILYLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYVEKEREKEVSDDEAEEEKVEKEEE
ESKDEEKPKIEDVGSDEEEEEGEKSKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQE
EYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRR
VFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFTEL
AEDKENYKKFYEAFSKNLKLGIHEDSTNRKRLSELLRYHTSQSGDEMTSLSEYVSRMKES
QKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKTLVSVTKE
GLELPEDEEEKKNMEESKAKFETLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWT
ANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKADANKNDKAVKDLVVLLF
ETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVIAEESSIAPPDEIPPLEGDEDTSR
MEEVD
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcaagtgcagcatggagaggacgaggtggagacgttcgccttccaggcggag
atcgcgcagctcatgtcgctcatcatcaacacgttctactccaacaaggagatcttcctg
cgggagctcatctccaacgcctccgacgcgctggacaagatccgctacgagagcctgacc
gacccctccaagctggacactgggaaggacctcaagatcgacatcgtccccaacccgcgg
gacccgactctcaccctgctggacaccggtatcgggatgaccaaagctgacctcgtcaac
aacctgggcaccattgccaaatcgggcaccaaagccttcatggaagccttgcaggcaggc
gcagacatctccatgatcgggcagtttggtgtgggtttctactccgcctacctggtggcc
gagaaggtggttgtcattaccaagcacaacgatgacgagcagtatgcctgggagtcgtca
gctgggggctccttcactgtccggactgaccacggtgagcccattggacggggcaccaaa
gtgatcctgtatttgaaggaggaccagacagagtatttggaggagagacgtgtcaaggag
gtggtgaagaagcactcccagttcattggctaccccatcacactttatgtggagaaggag
cgtgagaaggaggtcagtgatgatgaggcagaggaggagaaagttgagaaagaagaggag
gagtctaaggatgaggagaaaccaaaaattgaggatgtgggctctgatgaggaggaggag
gagggagagaaaagcaagaagaaaaagacaaagaaaatcaaggagaaatatattgaccag
gaggagctgaacaagaccaaacctatttggacccgcaaccctgatgacatcacccaggag
gagtatggcgagttctacaaaagcctcaccaatgactgggaggaccacttggcagtcaag
cacttctccgtggaagggcagctggagttcagggccctgctcttcatcccacgccgtgct
ccttttgatctctttgagaacaagaagaagaagaacaatattaagctgtatgtgaggcgt
gtcttcattatggacagctgtgatgagctcattcctgagtacctgaacttcatccgaggt
gttgtggattcagaagatctacctctgaacatatctcgtgagatgttgcagcagagcaaa
atcctcaaggtgatccgcaaaaacattgtgaaaaagtgcttggagctcttcactgagttg
gcagaggacaaagagaactacaagaaattttatgaggccttttccaagaatctgaagctg
ggcatccatgaggactcgacgaaccgaaagcgtctttcagagctgctgcgctaccacaca
tctcagtcaggtgatgagatgacttcactttcagagtatgtgtcccgtatgaaggagtcg
cagaagagtatctactatattacaggggagagcaaggaacaggttgccaactcagccttt
gtggagcgtgtgaggaagcgtggctttgaggtggtgtacatgacggagcctatcgatgaa
tactgcgtgcagcagctcaaggagtttgatgggaaaaccctagtgtcagttactaaggag
ggcctggagctacctgaggatgaggaggagaaaaagaatatggaggagagcaaggccaag
tttgagaccctctgcaaactcatgaaggaaatcctggacaagaaggtggagaaggtaact
atctcaaaccggttggtctcatctccctgctgcattgtcaccagcacatatggttggacg
gcaaacatggagcgcatcatgaaggctcaggcactgcgggacaactccaccatgggctat
atgatggccaagaagcacctggaaatcaaccctgaccacccaattgtggaaacgctccgc
cagaaggctgatgctaacaagaatgacaaagctgtcaaagatctggtggtcctactcttt
gagactgctctgctgtcctctggcttctccctggaagatcctcagacccattccaaccgc
atctacaggatgatcaaactggggcttggtattgatgaagatgaggtgattgcagaagag
tctagtatagctcctcctgatgaaatcccacctctggagggagatgaagacacatcccgc
atggaagaggtggactaa

DBGET integrated database retrieval system