KEGG   Gallus gallus (chicken): 396190
Entry
396190            CDS       T01006                                 

Gene name
UBC
Definition
(RefSeq) polyubiquitin-C
  KO
K04551  ubiquitin B
Organism
gga  Gallus gallus (chicken)
Pathway
gga04120  Ubiquitin mediated proteolysis
gga04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    396190 (UBC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    396190 (UBC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    396190 (UBC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396190 (UBC)
Ubiquitin system [BR:gga04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   396190 (UBC)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   396190 (UBC)
  Exosomal proteins of other body fluids (saliva and urine)
   396190 (UBC)
  Exosomal proteins of colorectal cancer cells
   396190 (UBC)
  Exosomal proteins of bladder cancer cells
   396190 (UBC)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 396190
NCBI-ProteinID: NP_001280103
CGNC: 49692
Ensembl: ENSGALG00000041277
UniProt: A0A1D5P546
Position
15
AA seq 229 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctcactggcaagaccatcaccttggaggtggaacccagt
gataccatcgagaatgtcaaggccaagatccaggacaaggagggcattccccccgatcag
cagaggctgatcttcgctggcaagcagctggaagacgggcgcaccctgtccgactacaac
atccagaaggagtccactctccatcttgtcctgcgcctcaggggtggcatgcagatcttt
gtgaagaccttgacaggcaagaccatcaccctggaggtcgagcccagtgacaccattgag
aacgtgaaggccaagatccaggacaaggagggcattccccccgatcagcagaggctgatc
tttgctggcaagcagctggaagatgggcgcactctgtccgactacaacatccagaaggag
tccaccctgcacctggtgctgcgcctcaggggagggatgcagatctttgtgaagaccttg
actggcaagaccatcaccctggaggtggaacccagcgacaccattgagaacgtgaaagcc
aagatccaggacaaggagggcattccccccgatcaacagaggctgatctttgctggcaag
cagctggaagatggacgcaccctgtctgactacaacatccagaaggagtccaccctgcac
ctggtgctgcgcctcaggggtggtaactga

DBGET integrated database retrieval system