KEGG   Gallus gallus (chicken): 396197
Entry
396197            CDS       T01006                                 

Gene name
ALB
Definition
(RefSeq) serum albumin precursor
  KO
K16141  serum albumin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396197 (ALB)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   396197 (ALB)
SSDB
Motif
Pfam: Serum_albumin
Other DBs
NCBI-GeneID: 396197
NCBI-ProteinID: NP_990592
CGNC: 14106
Ensembl: ENSGALG00000035219
Position
4
AA seq 615 aa
MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR
CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK
ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP
AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ
ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS
GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY
EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC
DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLPEDRRMACSEGY
LSIVIHDTCRKQETTPINDNVSQCCSSSYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK
LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG
ANLIVQSRATLGIGA
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgaagtgggtaacattaatttcattcattttcctcttcagttcagcaacatccaggaat
ctgcaaagatttgctcgtgatgcagagcacaagagtgaaattgcccatcgctacaatgat
ttgaaagaagaaacatttaaggcagttgccatgatcacatttgcccagtatctccagagg
tgctcttatgaaggactgtctaagcttgtgaaggatgttgttgatctggcacaaaaatgt
gtagccaatgaagatgctcctgaatgctcaaaaccactgccttccattatcctggatgaa
atctgccaagtggaaaagctccgtgactcttatggtgcaatggccgactgctgtagcaaa
gctgatcctgaaagaaatgagtgtttcctgtcatttaaagtttcccaaccagacttcgtt
cagccataccaaagaccagcttctgatgtgatatgccaggaataccaggacaacagagtg
tcatttctgggacatttcatctattctgttgcaagaagacaccccttcttgtatgcccct
gcaatccttagttttgctgttgattttgaacatgcacttcaaagctgttgcaaagagagt
gatgtcggtgcttgcctggacaccaaggaaattgttatgagagaaaaagccaagggagta
agtgtgaagcagcagtatttttgtggaatcttgaagcagttcggagatagagttttccaa
gcacgacaacttatttacctaagccaaaaataccccaaggctccattctcagaggtttct
aaatttgtacatgattctatcggcgtccacaaagagtgctgtgaaggggacatggtggag
tgcatggatgacatggcacgtatgatgagcaatctgtgctctcaacaagatgttttctca
ggtaaaatcaaagactgctgtgagaagcctattgtggaacgaagccagtgcattatggag
gcagaatttgatgagaaacctgcagatcttccttcattagttgaaaagtacatagaagat
aaggaagtgtgtaaaagttttgaagcaggccacgatgcattcatggcagagttcgtttat
gaatactcacgaagacaccctgagttctccatacagcttattatgagaattgccaaagga
tatgaatcacttctggaaaagtgctgcaaaactgataaccctgctgagtgctacgcaaat
gctcaagagcaactgaaccaacatatcaaagaaactcaggatgttgtgaagacaaactgt
gatcttctccatgaccatggcgaggcagacttcctcaagtccatcctgatccgctacact
aagaaaatgcctcaagtaccaactgatctcctgcttgaaactggaaagaaaatgacaact
attggtactaagtgctgccagcttcctgaagacagacgcatggcttgttctgagggttat
ctgagcattgtgattcatgatacgtgcaggaaacaggagaccacacctataaatgacaac
gtttcacaatgctgcagcagctcctatgctaacagaagaccatgtttcactgctatggga
gtagataccaaatatgttcctccaccatttaatcctgatatgttcagctttgatgaaaaa
ttgtgcagtgctcctgctgaagaacgagaagtaggccagatgaaattgctaatcaacctc
attaaacgcaagccccagatgacagaagaacaaataaagacaattgctgatggtttcact
gccatggttgacaagtgctgcaagcagtcggacatcaatacatgctttggagaagagggt
gccaacctaatagtccaaagcagagccacattaggaattggtgcttaa

DBGET integrated database retrieval system