KEGG   Gallus gallus (chicken): 396199
Entry
396199            CDS       T01006                                 

Symbol
PARP1
Name
(RefSeq) poly [ADP-ribose] polymerase 1
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03410  Base excision repair
gga04210  Apoptosis
gga04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    396199 (PARP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    396199 (PARP1)
   04217 Necroptosis
    396199 (PARP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gga03032]
    396199 (PARP1)
   03036 Chromosome and associated proteins [BR:gga03036]
    396199 (PARP1)
   03400 DNA repair and recombination proteins [BR:gga03400]
    396199 (PARP1)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     396199 (PARP1)
DNA replication proteins [BR:gga03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    396199 (PARP1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    396199 (PARP1)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     396199 (PARP1)
SSDB
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2
Other DBs
NCBI-GeneID: 396199
NCBI-ProteinID: NP_990594
CGNC: 7010
Ensembl: ENSGALG00000009228
UniProt: F1NL05
Structure
PDB: 

Position
3
AA seq 1011 aa
MAETGDKPYRAEYAKSGRASCKKCGESIAKDSLRLALMVQSPMFDGKVPHWHHYSCFWKR
ARIVSHTDIDGFPELRWEDQEKIKKAIETGGPAGGKGGDQEGGGKAEKSLTDFAAEYAKS
NRSTCKGCEQKIEKGQIRISKKMVHPEKPQLGMIDNWYHPDCFVSRRAELGFLPAYGATQ
LLGFSILKAEDKETLKKQLPATKTEGKRKGEEVDGNVVAKKKSRKEKEKESKQEKQLKEQ
TELIWGIKDELRKVCSTNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQ
FVFKSDAYYCSGDITAWTKCVAKTQTPNRKDWVIPKEFREIPYLKKFKCKKQDRIFPPEA
ATVNSAPPPSASAPLTETVTAPQEKPLTNMKILTLGKLSKNKEEVKNIVEELGGKMTTTA
NKATLCISTQKEVEKMSKKMEEVKDAKVRVVSEEFLKDVKSSSKGFQELLSLHAISPWGA
EVKTEHQEVAVDGKCSKPANMKSAGKVKEEQGPSKSEKKMKLTVKGGAAVDPDSGLEDSA
HVFEKGGKIFSATLGLVDIVKGTNSYYKLQLLEDDRESRYWVFRSWGRVGTVIGSNKLEQ
MPSKEDAVEHFLNLYEEKTGNSWHSKNFTKYPKKFYPLEIDYGQDEEAVRKLTVSAGTKS
KLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSILNEVQQAVSDG
GSESQILDLSNRFYTLIPHDFGMKKPPLLSNLEYIQAKVQMLDNLLDIEVAYSLLRGGNE
DGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHNAYDLKVVEIFRIEREG
ESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSK
SANYCHTSQADPIGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTT
LDGVEVPLGNGISTGINDTCLLYNEYIVYDVAQVNLKYLLKLKFNYKTSLW
NT seq 3036 nt   +upstreamnt  +downstreamnt
atggcggagacgggggacaagccgtaccgcgcggagtacgccaagagcgggcgggcgtcg
tgcaagaagtgcggcgagagcatcgccaaggactcgctgcgcctggccctcatggtgcag
tcgcccatgttcgatggcaaagtccctcactggcaccactacagctgcttctggaagcgg
gcgcggatcgtgtcccacacagacatcgatggcttccctgagctccgctgggaggaccag
gagaaaatcaagaaggctattgaaaccggaggccctgcaggaggaaaagggggggaccag
gaaggaggtggcaaggctgagaagagcctaactgactttgctgcagagtatgccaagtct
aacaggagtacttgcaaaggctgtgagcagaaaatagaaaagggccagattcggatttcc
aagaagatggtgcatcctgagaaaccacagctggggatgatcgataactggtaccacccg
gactgcttcgtcagccgccgggcagagctgggcttcctcccagcatatggggccacacag
ctcctgggtttcagcatcttgaaagctgaagataaagaaactctgaagaaacagctacca
gctactaagactgaaggaaagagaaaaggagaagaggtagatggaaatgtggttgcaaaa
aagaaatcaagaaaagaaaaagaaaaagaatcaaagcaggaaaaacagctgaaggagcag
acagagctgatctggggcatcaaggatgagctgaggaaggtctgctccacgaatgacctg
aaagagctgctgatcgccaacaagcaggaggtgccttcaggggagaatgcaatcttggac
agagtggcagacgggatggcgtttggagctctgcttccttgtgaggagtgtaaagggcag
tttgtgttcaagagcgatgcatactactgctcaggggacattactgcctggactaagtgt
gtggctaaaacacagactcccaataggaaagactgggtaatcccgaaggaatttcgtgag
attccttatctcaaaaaatttaagtgtaagaagcaggataggatattccctcctgaggct
gcaactgtgaactctgcaccgcctccatctgcatccgctccattgacagagactgtcact
gcaccccaagagaaaccactgaccaacatgaagatcctgactcttggaaagctgtccaag
aacaaggaggaagtgaagaatattgtggaggagctgggaggaaagatgacaacaacagct
aacaaggccaccctgtgcatcagcacacaaaaggaggtggagaaaatgagcaagaagatg
gaagaagtgaaggatgccaaagttcgtgtggtctcagaggagtttcttaaggatgtgaaa
tcttccagcaagggctttcaggagcttctctctctccatgcaatttcaccttggggtgca
gaggtgaaaacggagcaccaggaggtggcggtggatgggaagtgcagcaagcctgcaaat
atgaagagtgctgggaaggtcaaagaagaacaaggacctagcaagtctgagaagaaaatg
aagctaacagttaaaggtggagcagcagtagatcctgattccggcttggaggattctgct
catgtctttgaaaaaggtgggaagattttcagtgcaactcttggcctagtggatattgtg
aaaggaacaaattcctattacaaactgcagctgctggaggatgacagagagagcaggtac
tgggtgttcagatcctggggtcgtgtgggcactgtcattgggagtaacaagctggagcag
atgccatcaaaagaagatgctgttgaacacttcctaaatttgtacgaagagaaaactggc
aattcttggcattcaaagaacttcactaaatatcccaaaaaattctacccactggaaata
gattatggacaggatgaagaagctgtcaggaaactgacagtgagtgctgggactaaatcg
aagcttgctaagccaatccaagaccttattaagatgatttttgatgtggagagcatgaag
aaagccatggtggaatttgagattgacctgcagaagatgccactggggaaactgagcaag
cgacagatccaaagtgcatactccatccttaacgaggttcagcaggcggtttctgacggt
ggttctgaatcccagatcttggacctctcaaaccgcttctatactctgatccctcatgac
tttgggatgaagaaaccacctcttctcagtaacttggaatacattcaggctaaagtgcag
atgttggacaacttgctcgatattgaggttgcttacagtcttctcagaggtggaaatgaa
gatggagacaaagacccaattgatatcaattatgaaaagctccgaactgatattaaggtg
gttgacaaagattcagaagaagccaagattattaaacaatacgtgaaaaatactcatgct
gctactcacaatgcatatgacctcaaagttgtggaaatcttcaggattgaacgtgaagga
gagagtcagcgttacaagccatttaagcagcttcataatcgccagctgctgtggcacggt
tcccgcaccaccaacttcgctggtatcctctcacagggtctccggatagctccccctgaa
gctcctgtgaccggctacatgtttgggaagggcatctactttgcagatatggtttccaag
agtgccaactactgtcacacatctcaagctgatccaattgggttaatactactgggagaa
gttgccctcggaaatatgtatgagctaaagaatgcttctcacataacaaaattgcccaag
ggaaaacatagtgtgaaaggcttgggcaaaactgcacctgatcccacagccactacaacc
cttgatggtgtagaagttcccttagggaatgggatctcaacaggaattaatgatacttgt
ctgctgtacaatgaatatattgtgtatgatgttgctcaggtaaatctgaagtacctgctg
aaactgaaattcaactataagacatcactctggtga

DBGET integrated database retrieval system