KEGG   Gallus gallus (chicken): 396202
Entry
396202            CDS       T01006                                 
Symbol
NRCAM
Name
(RefSeq) neuronal cell adhesion molecule precursor
  KO
K06756  neuronal cell adhesion molecule
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    396202 (NRCAM)
SSDB
Motif
Pfam: Ig_3 I-set fn3 Ig_2 ig Bravo_FIGEY V-set C2-set_2 Pur_ac_phosph_N Ig_5 Adeno_E3_CR1 INCA1 SIT
Other DBs
NCBI-GeneID: 396202
NCBI-ProteinID: NP_990597
CGNC: 49697
Ensembl: ENSGALG00000009514
UniProt: P35331
Position
1:28703928..28846685
AA seq 1268 aa
MMKEKSISASKASLVFFLCQMISALDVPLDSKLLEELSQPPTITQQSPKDYIVDPRENIV
IQCEAKGKPPPSFSWTRNGTHFDIDKDAQVTMKPNSGTLVVNIMNGVKAEAYEGVYQCTA
RNERGAAISNNIVIRPSRSPLWTKEKLEPNHVREGDSLVLNCRPPVGLPPPIIFWMDNAF
QRLPQSERVSQGLNGDLYFSNVQPEDTRVDYICYARFNHTQTIQQKQPISVKVFSTKPVT
ERPPVLLTPMGSTSNKVELRGNVLLLECIAAGLPTPVIRWIKEGGELPANRTFFENFKKT
LKIIDVSEADSGNYKCTARNTLGSTHHVISVTVKAAPYWITAPRNLVLSPGEDGTLICRA
NGNPKPSISWLTNGVPIAIAPEDPSRKVDGDTIIFSAVQERSSAVYQCNASNEYGYLLAN
AFVNVLAEPPRILTPANKLYQVIADSPALIDCAYFGSPKPEIEWFRGVKGSILRGNEYVF
HDNGTLEIPVAQKDSTGTYTCVARNKLGKTQNEVQLEVKDPTMIIKQPQYKVIQRSAQAS
FECVIKHDPTLIPTVIWLKDNNELPDDERFLVGKDNLTIMNVTDKDDGTYTCIVNTTLDS
VSASAVLTVVAAPPTPAIIYARPNPPLDLELTGQLERSIELSWVPGEENNSPITNFVIEY
EDGLHEPGVWHYQTEVPGSHTTVQLKLSPYVNYSFRVIAVNEIGRSQPSEPSEQYLTKSA
NPDENPSNVQGIGSEPDNLVITWESLKGFQSNGPGLQYKVSWRQKDVDDEWTSVVVANVS
KYIVSGTPTFVPYEIKVQALNDLGYAPEPSEVIGHSGEDLPMVAPGNVQVHVINSTLAKV
HWDPVPLKSVRGHLQGYKVYYWKVQSLSRRSKRHVEKKILTFRGNKTFGMLPGLEPYSSY
KLNVRVVNGKGEGPASPDKVFKTPEGVPSPPSFLKITNPTLDSLTLEWGSPTHPNGVLTS
YILKFQPINNTHELGPLVEIRIPANESSLILKNLNYSTRYKFYFNAQTSVGSGSQITEEA
VTIMDEVQPLYPRIRNVTTAAAETYANISWEYEGPDHANFYVEYGVAGSKEDWKKEIVNG
SRSFFVLKGLTPGTAYKVRVGAEGLSGFRSSEDLFETGPAMASRQVDIATQGWFIGLMCA
VALLILILLIVCFIRRNKGGKYPVKEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKK
GSRTPSDRTVKKEDSDDSLVDYGEGVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSP
VNAMNSFV
NT seq 3807 nt   +upstreamnt  +downstreamnt
atgatgaaagagaagagcatatctgcaagcaaagcttccttggttttctttctgtgccaa
atgatttctgcattggatgtacctcttgattcaaaacttctagaagaattgtctcaacct
ccaacaataactcagcagtctccaaaagattacattgttgaccctcgagagaatattgta
atacaatgtgaagcaaaaggaaaaccacctcctagcttctcctggacgcgcaatggaact
cattttgatatagataaagatgcacaggtaacaatgaaaccaaattcaggaacccttgtt
gtaaatattatgaatggtgtgaaggcagaagcatatgaaggagtataccagtgtacagca
aggaatgaaagaggagcagccatttccaacaatattgttatacggccatctagatcccct
ttgtggactaaagaaaaactagaaccaaatcatgttcgagaaggtgattccctagtacta
aactgcagacctcctgttggcttaccaccacctataatattttggatggataatgctttc
caaaggctgcctcaaagtgaaagagtttctcaaggtctcaatggagacctttatttttct
aatgtacaaccagaggacacccgtgtggactatatctgctacgcgagatttaatcacaca
caaactatacagcagaaacaacccatttctgtaaaagtcttttcaaccaagccagttaca
gaaaggccaccagttcttcttacaccaatgggcagcacaagtaacaaagtggaactgaga
ggaaatgttcttttgttggaatgcatcgcagcaggattacccacaccagtaatccgctgg
attaaagagggtggtgaactgccagccaacagaacgttttttgaaaattttaagaaaact
ctcaagattatagacgtctctgaagctgactctgggaactacaaatgtacagcaagaaat
acattgggttctactcatcatgtcatttcggtaactgtaaaagctgccccatactggata
acagcacccaggaacttagtattgtctcctggagaagatgggacattgatctgcagagct
aatggcaacccaaaacctagcataagctggttaacaaatggcgttcccatagcaattgcc
ccagaagatcctagcagaaaggtagatggggataccattattttctcagctgtgcaagaa
cggtcaagtgctgtttatcagtgcaatgcttctaatgagtatggatacttgctggcaaat
gcatttgtgaatgttcttgctgagccaccaaggattctaactcctgctaataaactctat
caagtcatcgcagatagtcctgcattaatagactgtgcttattttggttcacctaagcct
gaaatcgaatggtttaggggagtgaaaggtagcatcttgcgaggaaatgaatatgttttc
catgataatggaaccttggaaattccagtggctcagaaggatagtactggcacatacaca
tgtgttgcaaggaataaattagggaagacgcaaaatgaagtacaactggaagttaaagac
ccaacgatgataattaaacagccacagtacaaagtgattcagagatctgcccaggcttca
tttgagtgtgtaataaaacatgatcctaccttaataccaacagttatatggctgaaagac
aataatgaactaccagatgatgaaaggtttctagttggtaaagacaacttgaccattatg
aatgtaactgataaagatgatggaacatatacttgcatagttaatactactctggacagt
gtttcagcaagtgctgtgcttactgttgttgctgctcccccaactccagctatcatttac
gctcggccaaatccaccgcttgacttggaattgacaggtcagctagaaagaagcattgaa
ctctcatgggtaccaggagaagaaaataacagtcccattacaaactttgtgattgagtat
gaagatggactacatgagccaggggtatggcattaccagacggaagttcctggatctcat
acaactgtacagttgaagttgtctccgtatgtcaactactcattccgtgtgattgctgtc
aatgaaattggtagaagtcagccaagtgaaccatctgaacagtacctgacaaagtccgca
aaccccgatgaaaatccttctaatgtacaagggataggctcggaacctgataatttggta
ataacgtgggagtctttaaaaggctttcagtctaatggaccaggactccaatataaagtc
agctggcgccagaaggatgttgatgatgaatggacgtccgttgtagttgcaaacgtgtct
aaatatattgtgtctggtacaccaacttttgttccctatgaaataaaagtacaggcttta
aatgacctgggatatgcaccagagccatcagaggttattggacattcaggggaagacttg
ccaatggttgctccaggcaatgtgcaggttcatgtcattaacagcacattggcaaaggtg
cactgggaccctgttccactaaaatctgtccgaggacatcttcaaggatataaagtttac
tactggaaagtacagagtctatccagaaggagtaaacggcatgtagaaaaaaagatcttg
actttcaggggaaacaagacttttggaatgttaccagggctagagccctatagttcttac
aagctgaatgttagagttgttaatggtaaaggagaaggaccagcaagcccagacaaagta
tttaaaactcctgaaggagttcctagcccaccctcctttttgaagattactaatccaaca
ctggactctctgactctggagtggggttcacctacccatccaaatggtgttttgacatca
tacatactgaagtttcagccaattaacaacacacatgaattaggtcccttggtagagata
agaatacctgccaacgagagcagcttgatattaaaaaatttaaattacagcacacgatac
aagttttactttaatgcacaaacatcagttggatcaggaagtcagataactgaggaagca
gtaacaattatggatgaagtgcaaccactttatccaaggatcagaaatgttacaacagct
gctgctgagacctatgccaatattagttgggagtatgagggaccagatcatgccaacttt
tatgttgaatatggtgtagcaggcagcaaagaagattggaaaaaagaaattgtaaatggt
tctcgaagcttctttgtgttaaagggtttaacaccaggaacagcatataaagtccgagtt
ggtgctgagggcctgtctggttttaggagttcagaggatctgtttgagacaggtccagca
atggcaagtcggcaggtagacattgctactcaaggatggttcattggacttatgtgtgct
gttgcacttcttatcttgattttattgattgtttgcttcataaggaggaataaaggtggc
aaatatccagtgaaggaaaaggaggatgcacatgctgatccagaaatacagcctatgaag
gaagatgatggaacatttggtgaatacagtgatgcagaggaccataaacctctaaaaaaa
ggaagtcggacaccgtcagacagaactgtgaaaaaagaagacagtgatgatagtttagtt
gactatggagaaggtgtaaatggccagttcaatgaggatggctcctttattggacaatac
agcggtaaaaaagagaaagaacctgcagaaggaaatgaaagttctgaggctccttctcct
gtaaatgccatgaattcatttgtgtaa

DBGET integrated database retrieval system