KEGG   Gallus gallus (chicken): 396214Help
Entry
396214            CDS       T01006                                 

Gene name
PLP1
Definition
(RefSeq) myelin proteolipid protein
  KO
K17271  myelin proteolipid protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396214 (PLP1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   396214 (PLP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myelin_PLP
Motif
Other DBs
NCBI-GeneID: 396214
NCBI-ProteinID: NP_990608
CGNC: 54
Ensembl: ENSGALG00000000112
UniProt: P23289
Position
4
AA seq 277 aa AA seqDB search
MGLLECCARCLIGAPFASLVATGLCFFGVALFCGCGHEALTGTEQLIETYFSKNYQDYEY
LIDVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYRTTICGKGLSATVTGG
PKGRGARGPQRAHSLQRVCQCLGKWLGHPDKFVGITYVLTIVWLLAFACSAVPVYIYFNT
WTTCQSIAFPTKTTASIGTLCADARMYGVLPWNAFPGKVCGSNLLSICKTSEFQMTFHLF
IAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgttggagtgctgtgcccgctgtctcataggggcacccttcgcctctctggtc
gccactgggctctgcttctttggggtcgcgctgttctgcggctgcgggcacgaagccctc
accggcaccgagcagctcattgagacctacttctccaagaactaccaggactacgagtat
ctcattgatgtcatccacgcttttcagtacgtcatctatggaacagcctccttcttcttc
ctctacggagccctgctgctggccgaaggcttctacaccaccggcgcagtccggcaaatc
ttcggggactaccggaccaccatctgcggcaagggcctcagcgcaacggtaactgggggc
ccgaaagggaggggagcgcgaggcccccagcgagctcactctttgcagcgggtgtgtcag
tgtttgggaaagtggctaggacatcctgacaagtttgtgggcattacctatgtcctgacc
atcgtctggctcctggccttcgcctgctccgccgtgcccgtctacatctactttaacacc
tggaccacctgccagtccatcgccttcccaaccaagaccactgccagcatcggcacgctg
tgcgcggacgccaggatgtacggtgtcctgccctggaacgcgtttcccgggaaggtgtgt
ggctccaacctgctctccatctgcaagaccagcgagttccaaatgactttccacctcttc
atcgcggcctttgtgggggctgccgccactctggtctcactgctcaccttcatgatcgcc
gccacttacaacttcgccgtcctcaagctgatgggccggggcaccaagttctag

DBGET integrated database retrieval system