KEGG   Gallus gallus (chicken): 396238Help
Entry
396238            CDS       T01006                                 

Gene name
YES1
Definition
(RefSeq) tyrosine-protein kinase Yes
  KO
K05705  tyrosine-protein kinase Yes [EC:2.7.10.2]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    396238 (YES1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396238 (YES1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    396238 (YES1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     396238 (YES1)
Protein kinases [BR:gga01001]
 Non-receptor tyrosine kinases
  SRC family
   396238 (YES1)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    396238 (YES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_10 SH3_3 YdjC zf-RING_14 hSH3
Motif
Other DBs
NCBI-GeneID: 396238
NCBI-ProteinID: NP_990632
CGNC: 49713
Ensembl: ENSGALG00000014860
UniProt: P09324
Position
2
AA seq 541 aa AA seqDB search
MGCIKSKEDKGPAMKYRTDNTPEPISSHVSHYGSDSSQATQSPAIKGSAVNFNSHSMTPF
GGPSGMTPFGGASSSFSAVPSPYPSTLTGGVTVFVALYDYEARTTDDLSFKKGERFQIIN
NTEGDWWEARSIATGKTGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF
LVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFESLQKLVKHYRE
HADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKV
AIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMTKGSLLDFLKE
GEGKFLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVL
EQVERGYRMPCPQGCPESLHELMKLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGDN
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcattaaaagcaaagaagataaaggtccagccatgaaatacaggactgataac
actccagaacctattagttcccacgtcagccattacgggtcagactccagccaagcaaca
cagtcaccggcaataaagggatcagcagttaattttaacagtcattccatgactcctttt
ggagggccctcaggaatgacaccctttggaggagcatcgtcttcattttcagctgtgcca
agtccatatcctagtactttaacaggtggtgttactgtatttgtggccttatacgattat
gaagctagaactacagatgacctttcatttaagaaaggtgaacggttccagataataaac
aacacggaaggcgactggtgggaagcaagatccattgctacgggaaaaacaggctacatc
ccaagcaattatgtagctcctgcagactccattcaagcggaagagtggtactttggtaaa
atgggcaggaaggatgcagaaagactacttttaaatcctgggaaccagcgtggtattttc
ttagtaagagagagcgaaaccactaaaggtgcttactccctttccatacgtgactgggat
gaggtcagaggtgataatgtgaagcactacaaaatcagaaaacttgacaatggtggatac
tatatcacaaccagagcacaatttgaatctctacagaagttggtgaagcactacagagaa
catgctgatggactgtgtcataagctaacaactgtatgtcccacggtgaaaccacaaaca
cagggactagcaaaagatgcctgggaaattcctagggagtctttgaggctggaagttaag
ttgggccaaggatgttttggtgaagtatggatgggaacctggaatggaaccacaaaagta
gccatcaagacacttaaacctggtacaatgatgcccgaagctttccttcaggaggctcag
atcatgaagaaattacgacatgacaagcttgttccactgtatgccgttgtttctgaggaa
ccaatctacatagtcaccgaattcatgacaaaaggcagcttactagacttcctgaaggaa
ggagaagggaagttcttaaaactcccacagctggtggacatggctgctcagattgctgat
ggcatggcttacattgaaagaatgaactacatccacagggatctccgggcagccaacatt
cttgtaggagacaatcttgtgtgtaaaatagcagacttcggtctcgcaaggttaatagag
gacaatgagtacactgcgaggcaaggagctaaatttccaattaaatggactgctccagaa
gcagcattgtatggtcggtttacaatcaagtcagatgtgtggtcgtttggaattttactg
acagagctggtaacaaaggggagagtgccatatccaggaatggtgaatcgggaagttctg
gaacaagtggaacgtggatataggatgccttgccctcagggctgcccggaatctctccac
gagttaatgaaactatgttggaagaaggaccctgatgagagaccaacatttgaatatata
cagtctttcctggaggactactttactgctacagaaccacagtaccagcctggggacaat
ttataa

DBGET integrated database retrieval system