KEGG   Gallus gallus (chicken): 396241
Entry
396241            CDS       T01006                                 

Gene name
TF
Definition
(RefSeq) ovotransferrin precursor
  KO
K14736  transferrin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    396241 (TF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396241 (TF)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   396241 (TF)
  Exosomal proteins of colorectal cancer cells
   396241 (TF)
SSDB
Motif
Pfam: Transferrin Phosphonate-bd
Other DBs
NCBI-GeneID: 396241
NCBI-ProteinID: NP_990635
CGNC: 49715
Ensembl: ENSGALG00000006453
UniProt: P02789
Structure
PDB: 

Position
9
AA seq 705 aa
MKLILCTVLSLGIAAVCFAAPPKSVIRWCTISSPEEKKCNNLRDLTQQERISLTCVQKAT
YLDCIKAIANNEADAISLDGGQVFEAGLAPYKLKPIAAEIYEHTEGSTTSYYAVAVVKKG
TEFTVNDLQGKNSCHTGLGRSAGWNIPIGTLLHWGAIEWEGIESGSVEQAVAKFFSASCV
PGATIEQKLCRQCKGDPKTKCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPDLN
DEYELLCLDGSRQPVDNYKTCNWARVAAHAVVARDDNKVEDIWSFLSKAQSDFGVDTKSD
FHLFGPPGKKDPVLKDFLFKDSAIMLKRVPSLMDSQLYLGFEYYSAIQSMRKDQLTPSPR
ENRIQWCAVGKDEKSKCDRWSVVSNGDVECTVVDETKDCIIKIMKGEADAVALDGGLVYT
AGVCGLVPVMAERYDDESQCSKTDERPASYFAVAVARKDSNVNWNNLKGKKSCHTAVGRT
AGWVIPMGLIHNRTGTCNFDEYFSEGCAPGSPPNSRLCQLCQGSGGIPPEKCVASSHEKY
FGYTGALRCLVEKGDVAFIQHSTVEENTGGKNKADWAKNLQMDDFELLCTDGRRANVMDY
RECNLAEVPTHAVVVRPEKANKIRDLLERQEKRFGVNGSEKSKFMMFESQNKDLLFKDLT
KCLFKVREGTTYKEFLGDKFYTVISNLKTCNPSDILQMCSFLEGK
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgaagctcatcctctgcaccgtgctgtccttggggatagcggctgtgtgtttcgccgct
ccccccaagtcagtcatcagatggtgcaccatatcctctccagaagagaagaaatgcaac
aacctcagggacctcacacaacaagagaggatttccttgacctgtgtgcagaaagcaacg
taccttgactgcattaaagccattgcgaataatgaggcagatgccattagcttggacggc
ggtcaagtgtttgaggcaggccttgccccatacaagctgaagcccattgctgctgagatt
tatgaacatactgaaggctccacaaccagctactatgctgtggccgttgtgaaaaaagga
accgaattcaccgtgaacgacttgcagggcaagaactcctgccacacggggctgggcagg
tctgcgggctggaacatccccattgggacactcctccactggggggccattgagtgggaa
ggcatagaatcgggctcagtggaacaagcggtggccaagtttttctctgccagctgcgtg
cccggtgccaccatcgagcaaaaactgtgccgtcagtgcaaaggagaccccaaaaccaag
tgtgcccgcaatgcaccttattctggatattctggagctttccattgtttgaaagatgga
aaaggagacgtggcttttgtgaagcacacaactgttaatgaaaatgccccggatctgaat
gatgagtatgagctgctgtgcctggatggcagccggcagcctgtggacaactacaagacc
tgtaactgggccagagtggctgctcacgccgtcgtggctcgggatgacaacaaggttgaa
gatatctggagcttcctctcaaaagcacagagtgactttggcgtggacaccaagagtgac
ttccacctctttgggccacctggaaagaaggacccggtcctcaaagacttccttttcaaa
gactctgccataatgctgaagcgcgtcccctcgctgatggattcccagctctacctgggc
tttgagtactacagtgccatccagagcatgcggaaagatcagctgactcccagccccaga
gaaaacaggatccaatggtgtgcagtaggcaaggatgagaagagcaagtgtgaccgctgg
agtgtggtgagcaacggggacgtggagtgcaccgtggtagacgagacaaaggactgcatc
attaagatcatgaaaggtgaagcagatgctgttgcccttgatggaggtctggtctatact
gctggtgtctgtggcctggtgccagtgatggcagaacgatatgacgatgaaagccaatgc
agcaaaacagatgaacgaccagcatcatactttgctgtggctgtcgcgaggaaagacagc
aacgtcaactggaacaatctgaagggcaagaaatcgtgccacaccgctgtggggaggact
gctggctgggtcatccccatgggcttgattcacaacagaacagggacctgcaatttcgat
gaatacttcagcgagggttgtgctcctggatcccctcctaactcccgcctctgccagctg
tgccagggctcagggggaatcccaccggagaagtgcgtcgccagcagccatgagaaatac
tttggatataccggagctttacggtgtctggtcgagaagggtgatgtggcctttattcag
cattccaccgttgaggaaaacactggcggcaaaaacaaagctgattgggccaagaatctg
caaatggatgactttgagttgctgtgcaccgacgggaggcgggcaaacgtcatggattac
agggaatgcaacctggctgaagttcctacccacgctgtggtcgtgcgcccggagaaagca
aacaaaatccgtgatctgctggagagacaggagaaacggtttggagtaaatggaagcgag
aaaagcaagttcatgatgtttgagtctcaaaacaaagatcttctgtttaaagacttaacc
aagtgcctgtttaaagtccgagaaggaacaacatacaaggagttccttggagataaattt
tatactgtgatttccaacctcaaaacctgcaacccatcagatatcctccagatgtgcagc
ttccttgagggcaagtaa

DBGET integrated database retrieval system