KEGG   Gallus gallus (chicken): 396246
Entry
396246            CDS       T01006                                 

Gene name
FABP7
Definition
(RefSeq) fatty acid-binding protein, brain
  KO
K08756  fatty acid-binding protein 7, brain
Organism
gga  Gallus gallus (chicken)
Pathway
gga03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    396246 (FABP7)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7
Other DBs
NCBI-GeneID: 396246
NCBI-ProteinID: NP_990639
CGNC: 49717
Ensembl: ENSGALG00000038933
UniProt: Q05423
Position
3
AA seq 132 aa
MVEAFCATWKLADSHNFDEYMKALGVGFAMRQVGNVTKPTVIISSEGDKVVIRTQSTFKN
TEISFKLGEEFDETTPDDRNCKSVVTLDGDKLVHVQKWDGKETNFVREIKDGRMVMTLTF
GDVVAVRHYEKA
NT seq 399 nt   +upstreamnt  +downstreamnt
atggttgaggctttctgcgcgacgtggaagctggcggacagccacaactttgacgaatac
atgaaggcgctgggagtggggtttgcgatgcggcaggtggggaacgtgactaagcccaca
gtgatcatcagcagcgagggggacaaagtcgtgatcaggactcagagcactttcaaaaac
acagaaatcagctttaaactcggcgaggaatttgatgaaaccacccccgacgacaggaac
tgcaaatcagttgtgaccctggatggagacaagctagttcatgtacagaaatgggatggc
aaagagacaaactttgtaagagaaataaaggatggcagaatggtaatgactcttaccttt
ggtgatgtggtggctgttcgccactatgagaaagcatag

DBGET integrated database retrieval system