KEGG   Gallus gallus (chicken): 396251
Entry
396251            CDS       T01006                                 

Symbol
THRA
Name
(RefSeq) thyroid hormone receptor alpha
  KO
K05547  thyroid hormone receptor alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    396251 (THRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396251 (THRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:gga03310]
    396251 (THRA)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    396251 (THRA)
Nuclear receptors [BR:gga03310]
 1. Thyroid hormone like
  1A. Thyroid hormone receptor (THR)
   396251 (THRA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 396251
NCBI-ProteinID: NP_990644
CGNC: 155
Ensembl: ENSGALG00000040017
UniProt: P04625
Structure
Position
27:7152162..7163448
AA seq 408 aa
MEQKPSTLDPLSEPEDTRWLDGKRKRKSSQCLVKSSMSGYIPSYLDKDEQCVVCGDKATG
YHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDGCCVIDKITRNQCQLCRFKKCISVGMAM
DLVLDDSKRVAKRKLIEENRERRRKEEMIKSLQHRPSPSAEEWELIHVVTEAHRSTNAQG
SHWKQKRKFLPEDIGQSPMASMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSEL
PCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGEMAVKREQLKNGGLGVVSDAIFDL
GKSLSAFNLDDTEVALLQAVLLMSSDRTGLICVDKIEKCQETYLLAFEHYINYRKHNIPH
FWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggaacagaagcccagcaccctggacccgctgtcggagccagaggacactcggtggctg
gatggcaagcgcaaaagaaagagcagccaatgtttggtgaagagcagcatgtcagggtac
atccctagctacctggacaaagatgaacagtgcgtggtgtgcggggacaaagccaccggc
taccactaccgctgcatcacctgcgagggctgcaagggctttttccgtcggaccatccag
aagaacctgcaccccacctactcctgcaagtacgatgggtgctgcgtcatcgacaagatc
acccgcaaccagtgccagctgtgccgcttcaagaagtgcatctccgtgggcatggccatg
gacctggtgctggacgactcgaagcgcgtagccaagcggaagctgatcgaggagaaccgg
gagcggcggcgcaaggaggagatgatcaaatccctgcagcaccggcccagccccagcgca
gaggagtgggagctgatccacgtggtgaccgaggcgcaccgcagcaccaacgcgcagggc
agccactggaagcagaagaggaaattcctgcccgaagatatcggtcagtcgcccatggcc
tccatgcctgacggggacaaagtggacctggaggcgttcagcgagtttacaaaaatcatc
acgccggccatcacccgcgtggtcgactttgccaaaaaactgcccatgttctcggagctg
ccgtgcgaggatcagatcatcctgctgaagggctgctgcatggagatcatgtcgctgcgc
gccgccgtgcgctacgaccccgagagcgaaacgctgacgctgagcggggaaatggccgtc
aaacgcgagcagctgaagaacggggggctgggggtcgtgtctgatgccatcttcgacctc
ggcaagtcgctgtctgccttcaacctggacgacaccgaggtggccctgctgcaggccgtg
ctgctcatgtcctcagaccggacggggctgatctgcgtggataagatagagaagtgccag
gagacgtacctgctggcgttcgagcactacatcaactaccgcaaacacaacattccccac
ttctggcccaagctgctgatgaaggtgacggacctgcgcatgatcggcgcctgccacgcc
agccgcttcctgcacatgaaggtggagtgccccaccgagctcttcccccccctcttcctc
gaggtcttcgaggaccaggaggtgtag

DBGET integrated database retrieval system