KEGG   Gallus gallus (chicken): 396252Help
Entry
396252            CDS       T01006                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04110  Cell cycle
gga04114  Oocyte meiosis
gga04115  p53 signaling pathway
gga04218  Cellular senescence
gga04540  Gap junction
gga04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    396252 (CDK1)
   04114 Oocyte meiosis
    396252 (CDK1)
   04115 p53 signaling pathway
    396252 (CDK1)
   04218 Cellular senescence
    396252 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    396252 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    396252 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396252 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gga03032]
    396252 (CDK1)
   03036 Chromosome and associated proteins [BR:gga03036]
    396252 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396252 (CDK1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     396252 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     396252 (CDK1)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  CDK family
   396252 (CDK1)
DNA replication proteins [BR:gga03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    396252 (CDK1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    396252 (CDK1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   396252 (CDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Kinase-like Kdo Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 396252
NCBI-ProteinID: NP_990645
CGNC: 2236
Ensembl: ENSGALG00000003085
UniProt: P13863
Position
6
AA seq 303 aa AA seqDB search
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELHH
PNIVCLQDVLMQDARLYLIFEFLSMDLKKYLDTIPSGQYLDRSRVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRSPEVLLGSAL
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNDVWPDVESLQDYKNT
FPKWKPGSLGTHVQNLDEDGLDLLSKMLIYDPAKRISGKMALNHPYFDDLDKSTLPANLI
KKF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggaggattacacgaagatagagaagattggggaaggtacctatggtgttgtgtataaa
gggcgccacaaaaccacaggccaagtggttgcaatgaagaaaatacgtctagaaagtgag
gaggaaggtgttccaagtactgctatccgagaaatttctttgttaaaagagctgcatcat
cccaatatagtctgtcttcaggatgttcttatgcaggatgcaaggctgtacctcattttt
gaattcctttccatggacctcaagaaatacttggatactattccatctggccaatatttg
gatcgttcgcgtgttaagagttacctgtatcagatcttgcaaggtatcgtcttctgccat
tcaagacgagttctgcacagagacttaaaacctcagaatcttctaatagatgacaaaggg
gtgattaaactggcagattttggattggctcgagcctttggaatcccggtgcgggtatac
actcatgaagtagtgacactgtggtacaggtctccagaggtactgctaggatctgctctg
tattccactcctgtagacatatggagcataggtaccatatttgcagagttagcaactaaa
aagccacttttccacggggactcagagattgaccagctcttcagaatcttcagagcttta
gggacacccaacaatgatgtgtggcctgatgtggaatccttgcaagactataaaaacact
ttcccaaaatggaaacctggcagcctgggaacgcatgtccaaaacttagatgaggatgga
ctcgatctgttgtctaaaatgttaatttatgatcctgcaaaaagaatttctggcaaaatg
gccttgaaccacccatacttcgatgacttggacaaatctactcttcctgctaatctgatt
aagaaattctaa

DBGET integrated database retrieval system