KEGG   Gallus gallus (chicken): 396259Help
Entry
396259            CDS       T01006                                 

Gene name
FGFR2
Definition
(RefSeq) fibroblast growth factor receptor 2 precursor
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04144  Endocytosis
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396259 (FGFR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    396259 (FGFR2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396259 (FGFR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396259 (FGFR2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    396259 (FGFR2)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    396259 (FGFR2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     396259 (FGFR2)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   396259 (FGFR2)
CD molecules [BR:gga04090]
 Proteins
  396259 (FGFR2)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   396259 (FGFR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM Ig_5 Ig_4 Kinase-like
Motif
Other DBs
NCBI-GeneID: 396259
NCBI-ProteinID: NP_990650
CGNC: 49722
Ensembl: ENSGALG00000009495
UniProt: P18461
Position
6
AA seq 823 aa AA seqDB search
MVSWDSGCLICLVVVTMAGLSLARPSFNLVVEDATLEPEEPPTKYQISQPDVHSALPGEP
LELRCQLKDAVMISWTKDGVPLGPDNRTVIIGEYLQIKDASPRDSGLYACTAIRTLDSDT
LYFIVNVTDALSSGDDEDDNDGSEDFVNDSNQMRAPYWTHTDKMEKRLHAVPAANTVKFR
CPAMGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCIVENQYG
SINHTYHLDVVERSPHRPILQAGLPANASAVVGGDVEFVCKVYSDAQPHIQWIKHVERNG
SKYGPDGLPYLQVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHTAWLT
VLPAPEKEKEFPTSPDYLEIAIYCIGVFLIACMVLTVILCRMKNTTKKPDFSSQPAVHKL
TKRIPLRRQVTVSADSSSSMNSNTPLVRITTRLSSTADAPMLAGVSEYELPEDPKWEFPR
DKLTLGKPLGEGCFGQVVMAEAVGIDKDRPKEAVTVAVKMLKDDATEKDLSDLVSEMEMM
KMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSFDINRVPEEQM
TFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYK
KTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKE
GHRMDKPANCTNELYMMMRDCWQAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSGPLEQ
YSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPKYQHMNGSVKT
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctgggattcgggttgccttatctgcctggtggtggtcaccatggctggactt
tccctggctcgaccgtcatttaacttagttgttgaagatgccactttggaacccgaagag
ccgccaaccaaataccaaatctctcagccagatgtacactctgcacttccaggagaacca
cttgagttgcgctgtcaattgaaagacgccgtcatgatcagttggactaaggatggggtc
cccttggggcccgacaataggacagtgattattggggagtacttacaaattaaagatgct
tcacccagagattcgggcctctatgcttgcactgctattaggaccctagacagtgatact
ctgtacttcattgtaaatgttacagatgctctttcttctggggatgatgaagatgacaat
gatgggtctgaggactttgtgaatgacagcaaccagatgagggcgccctattggacacac
acagacaaaatggagaaaaggttacacgcagtgccagcagcaaacactgtcaagtttcgt
tgcccagccatgggaaacccaacaccaaccatgagatggctgaaaaatgggaaagagttt
aaacaagaacatcgtattggcggctataaggtccgcaaccagcactggagtctcatcatg
gagagcgtagtcccatccgacaaaggaaattacacgtgcatcgtggaaaaccagtatggc
tccatcaaccacacttaccatctcgatgttgtcgagcgatcaccgcacaggcccatcctc
caggctggccttccagcaaacgcctcggctgtagtcggaggtgatgtcgagtttgtctgc
aaagtctacagtgatgctcaaccccacattcagtggataaaacacgtagagaggaatggc
agtaaatacggaccagatggactgccttaccttcaggttttaaaggctgccggtgttaac
actacggacaaagaaattgaggttctctatatacggaatgtaacttttgaggatgctggg
gagtatacatgcttggcgggtaattctattgggatatcctttcacactgcatggttgaca
gttctgccagctcctgaaaaggaaaaggaatttcccacatctccagactacctggaaata
gcaatttactgcataggggtcttcctgatcgcctgcatggtgctgacagtcatcctgtgc
cgcatgaagaacaccaccaagaagcctgacttcagcagccagcccgctgtccacaagctg
acaaagcgaatccctctgcgcagacaggtaacagtgtcagctgactcaagctcctccatg
aactccaacacgcctctggtgaggataactacacgcctctcctccactgctgatgcccca
atgctggcaggggtctcggaatatgaactgccagaggatccaaaatgggagtttccaagg
gataagctgacgctgggtaaacccctgggggaaggctgctttgggcaagtggtgatggct
gaagcggtggggattgacaaagaccggcccaaagaagcagtgactgtggcagtgaagatg
ctgaaagatgatgctacggaaaaggatctatccgacctggtgtcagagatggagatgatg
aagatgattgggaaacataaaaatatcatcaatcttcttggagcctgtacccaggatggt
ccgctgtatgtgattgtagaatatgcttccaaaggaaacctgcgtgagtacctgcgagca
cgccgccctcctgggatggaatactcctttgatattaacagggtcccagaggagcagatg
acattcaaggacttggtatcctgcacgtaccagttggcaagaggcatggagtacttggct
tcacaaaaatgtatccaccgagacctagctgcaagaaatgttttggtaactgaaaataac
gtcatgaaaatagcagacttcggtttagccagagacatcaacaatatagattattataaa
aagactactaatggacggcttccagtaaagtggatggctccagaagctctgtttgacaga
gtttacacacaccaaagcgacgtatggtcatttggtgtgctaatgtgggagatcttcacc
ttaggaggatcgccctacccaggaatcccagtggaggaactttttaagctgcttaaagaa
gggcaccgaatggataaacctgccaactgcaccaatgaactctacatgatgatgagagat
tgctggcaggctgtgccttcacaaagaccaacttttaaacagttggtagaagacttggat
cggatccttactctcacaactaacgaggagtatctggacctcagcggacctctggagcag
tattcacctagctaccctgacaccaggagttcgtgttcttcaggtgatgactctgttttt
tctcctgatccaatgccttatgaaccctgtcttcccaagtaccaacacatgaatgggagc
gttaaaacatga

DBGET integrated database retrieval system