KEGG   Gallus gallus (chicken): 396270
Entry
396270            CDS       T01006                                 

Gene name
INCENP
Definition
(RefSeq) inner centromere protein
  KO
K11515  inner centromere protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    396270 (INCENP)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     396270 (INCENP)
SSDB
Motif
Pfam: INCENP_ARK-bind INCENP_N
Other DBs
NCBI-GeneID: 396270
NCBI-ProteinID: NP_990661
CGNC: 5686
Ensembl: ENSGALG00000007537
UniProt: P53352
Position
5
AA seq 839 aa
MAVATGLARLPVVCNQRLAELLRQVDDVDLLWLEEIHEEAARMFGSHYSDQPELMPKTPS
QKNRKRRKRPSALRGESLELGRRRLSRRRTNNLKAVSSKRDSQRLQNKEDTEGLGTEAQE
LSSQTVSRRLTRSQVAAPADRSEVLPEHLRERVVPVVEISVCDRISAEFQFQKCASERAE
NHSASLPPSSDDKSPKESSAAESQPLPAASELIVPHTPEAKGAGKNKSAFKKTANVADTT
VVLSEKELGLEEVDDSTQVQKHNERDDKEPSQRTTDSPETPTGSRLSRRSVRRSLMGKPS
TIRRTSLAEKYSLARKRESTIRKSIARTVIKRKAPQKLSVSSSSVNGSGSEEVPEDEETV
VNAGPPPVPQTPPKLDFQGLRMSLRSQTVNRNEQQQETSNNECDLSKSEKTQEPPQSARR
KTSYKRAVDQRYDTQQAEDGGLSPLRKKTPSPPCPASKVVRPFKTFLHTVQKNQLLMTPS
SVGRNGVIKSFIKYNTPLQHDPKEKERQKLQALRKKEEAEQLRKQKVEEEKKRRQEEAKL
RREERLRKVLQARERAEQLEEERKRRIEQKLALFDEKTEKAREERLAEEKIKKRAAAKKM
EEAEARRRQDEEARKQKALQQEEEERRHKELMQKKKEEEQERARKIAEQRQAEQEREKQL
AAEREQERKKEQERKKEEERIQAEKQREQQEKAARLQKEVLAAKEQLQKEMEKKENSPAC
NSYQMTPQYHKDPKPPKINPNNYGMDLNSDDSTDDESQPRKPIPAWASGNQLSQAVIRQY
YNPPNVDALFGTIVSPKLEDIFYKSKPRYFKRTSSAVWNSPPFPGAKSVLGLPYSLKKY
NT seq 2520 nt   +upstreamnt  +downstreamnt
atggcggtggcaacgggcctggcgcggctgcccgtggtgtgcaaccagcggctggcggag
ctcctgaggcaggtggacgacgtcgacctgttgtggctggaagagatccacgaggaggcg
gccaggatgttcggcagccactacagcgaccagccggagctgatgccgaagacgccgtcg
cagaagaaccggaagaggaggaagcggccgtccgctctgcggggcgagagcctggagctg
ggcaggaggagattatctagaaggaggactaacaacctcaaagcggtgtcctccaagaga
gattctcagcgactccaaaataaagaagacacagaaggactcggcaccgaggcccaagaa
ctctcaagccaaactgtctcccggcggttgacaagatcccaggttgctgcacctgccgac
cgctcagaggtccttcctgaacatctcagagaaagggtagttcccgtagtagaaatcagt
gtctgtgatcgcattagcgctgagtttcagttccagaagtgtgcatctgaacgagcagag
aaccactccgcaagcctccccccgagctcagatgacaagtctccaaaggagagcagtgct
gcagaatcacagcctttgcctgctgcatctgagctcatagtccctcataccccagaggca
aaaggtgcaggaaagaacaagagcgcatttaagaagacagcaaatgtagctgatactaca
gttgttttaagtgaaaaagagctcgggctggaagaggtggatgactctactcaggtgcaa
aagcataatgagagggatgataaagaaccttctcagcgtacaacagatagcccggaaact
ccaacaggctccaggctaagccgtcgctctgtgcgtagaagtttgatgggcaaaccttcc
acgattcgtagaacctcactggcagagaaatactcactagcccgtaagagggaaagcact
attcggaaatctatcgccaggacagtgatcaagcgtaaggcgccccaaaagttatctgtg
tcctccagttccgtgaatggctcgggttctgaagaggtgccagaagatgaagaaacagtt
gtcaacgctggaccacctcctgtacctcagacccctccaaagctggatttccaaggcctg
cggatgtcacttcgctctcagactgtcaacagaaatgaacaacagcaggagacgagcaac
aacgaatgtgacttaagtaagagtgagaagacccaggaaccaccccaaagtgccaggaga
aagacaagttacaaaagagctgtggatcaacgctatgacacccagcaagcagaagatgga
gggctttctcctctcagaaaaaagactccatcccctccatgtccggctagcaaagttgta
cgtcctttcaaaacatttttgcacaccgtgcagaagaatcagctcctaatgaccccaagc
tctgtggggagaaatggagtaataaagtcttttatcaagtacaacacgcctctccaacat
gaccccaaggaaaaggagagacaaaaactgcaggctctgagaaagaaggaagaggctgag
cagttgagaaaacaaaaagtggaggaagaaaagaaacggcgacaagaagaggcaaagttg
aggcgtgaagaacgcctgcgtaaagtgttgcaagctcgggaacgggcagagcaattggaa
gaagagaggaaaaggcgcattgagcagaagctagctctgtttgatgagaagacagagaag
gcgcgggaagaaagactggcagaagagaagatcaaaaagagagcagctgccaagaaaatg
gaagaagcggaggcccggcgcaggcaggatgaagaggccagaaaacaaaaagcactgcag
caggaggaagaggaacgtcggcacaaagagctaatgcagaagaagaaagaagaggagcag
gaacgtgccaggaaaattgctgagcagaggcaggcagaacaggagagagaaaaacagttg
gctgcagagagagagcaggagaggaagaaggagcaggagaggaagaaggaggaggagagg
attcaggcagaaaagcaacgtgaacagcaagagaaggcagctcgcctgcagaaggaagta
ttggctgctaaagaacagctccagaaggagatggagaaaaaagaaaattcacctgcctgc
aattcataccagatgactccacagtaccataaagatccaaagccccccaagataaatcca
aataactatggaatggatctgaacagtgatgattctactgatgatgaaagccagcctcgc
aaacccatccctgcctgggccagtgggaatcagcttagccaagcagtaatccgccagtac
tacaaccctcccaatgttgatgcactctttgggaccattgtaagccccaagttggaggac
atcttttacaaaagcaaaccacgctacttcaagcgcaccagctctgctgtgtggaactcc
ccaccatttccaggtgccaaatcggttctaggtctgccatacagcctgaaaaagtactga

DBGET integrated database retrieval system