KEGG   Gallus gallus (chicken): 396273
Entry
396273            CDS       T01006                                 

Gene name
GSC
Definition
(RefSeq) homeobox protein goosecoid
  KO
K09324  homeobox protein goosecoid
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396273 (GSC)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    396273 (GSC)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 396273
NCBI-ProteinID: NP_990662
CGNC: 8338
Ensembl: ENSGALG00000010974
UniProt: P53545
Position
5
AA seq 245 aa
MPASMFSIDNILAARPRCKDSVLLPPSAPVVFPSLHGDSLYGAASDYGGFYSRAVAPGSA
LPAVGRSRLGYNNYYYGQLHVATSPVGPSCCGAVPPLGAQQCSCVPPAGYEGAGSVLMSP
VPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTR
EQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAQKWNKASKTSPEKRQEDGKSD
LDSDS
NT seq 738 nt   +upstreamnt  +downstreamnt
atgcctgcgagcatgttcagcatcgacaacatcctggcggccagacctcgctgcaaggac
tcggtgctgctgcccccgagcgcgcccgtcgtcttccccagcctgcacggggactccctc
tacggcgctgcctccgactacggaggattttactcccgggctgtggctcccggctcggcg
ctgccggcggtcggccggtcccgcctgggctacaacaactactactacgggcagctgcat
gtcgccacgtctcccgtgggcccgtcgtgttgcggggccgtgccgccgctgggggcccag
cagtgctcctgcgtgccccccgcaggttacgagggcgctgggtcggtgctgatgtcccct
gttccccatcagatgttgccttacatgaacgtaggcactttgtcccgaacggagctgcag
ttactcaaccagctgcactgcaggaggaaaagacggcaccggactatcttcactgacgag
cagctcgaagcgctggaaaacctcttccaggaaacgaaatacccagacgtgggcaccagg
gaacagctggcgaggaaggtgcacttaagagaggagaaagtggaggtttggttcaaaaac
cgccgggcgaaatggaggaggcaaaagcggtcgtcttccgaggagtcggaaaatgcacag
aaatggaataaagcgtctaaaacgtctccggagaagaggcaagaagacgggaaaagcgat
ttggactccgacagctga

DBGET integrated database retrieval system