KEGG   Gallus gallus (chicken): 396279
Entry
396279            CDS       T01006                                 

Gene name
SST
Definition
(RefSeq) somatostatin precursor
  KO
K05237  somatostatin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    396279 (SST)
SSDB
Motif
Pfam: Somatostatin
Other DBs
NCBI-GeneID: 396279
NCBI-ProteinID: NP_990667
CGNC: 5562
Ensembl: ENSGALG00000007361
UniProt: P33094 A5YW27
Position
9
AA seq 116 aa
MLSCRLQCALALLSIALAVGTVSAAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
SQTENEALESEDLSRGAEQDEVRLELERSANSNPALAPRERKAGCKNFFWKTFTSC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgctgtcgtgccgcctgcagtgcgccctggccctgctctccatcgccttggccgtcggc
accgtctcggccgccccctcggacccccggctccggcagttcctgcagaagtccctggct
gccgccgccgggaagcaggaactggccaagtactttttggcagaactgctctcagagcca
agccagacagaaaatgaagctctggagtcggaggacttgtcccgaggggccgagcaggat
gaagtgagactggagctggagcgctcggccaactcaaaccccgcgctggctccccgggaa
cgcaaagcgggctgcaagaacttcttctggaaaactttcacatcctgttag

DBGET integrated database retrieval system